Loading...
HomeMy WebLinkAboutBACKGROUND & EXHIBITSAJR BPuakeaSPP COUNTY OF HAWAII PLANNING DEPARTMENT BACKGROUND REPORT PUAKEA RANCH DBA: KAPUNAKANE RANCH LLC SPECIAL PERMIT APPLICATION SPP-20-000219 PUAKEA RANCH DBA: KAPUANKANE RANCH LLC has applied for a Special Permit to establish a Guest Ranch on a 14.9-acre portion of the larger 32.411-acre subject parcel. The Guest Ranch will offer overnight accommodations, activities and events for guests, local schools, and community members as well as ranch and faming activities. The property is located mauka(landward)of Akoni Pule Highway(State Highway 270) approximately 2.0 miles south of Hawi town, Puakea,North Kohala, Hawai'i, TMK: (3) 5-6-001: por. 082. APPLICANTS REQUEST 1) Request: The applicant is requesting a Special Permit to allow for the expansion/continued use of the existing Guest Ranch on a 14.9-acre portion ofthe 32.411-acre subject parcel. The remaining land area would continue to be used as grazing pastures, orchards, animal corrals, and open space. All new structures will be built in a smaller 2.14-acre site within the larger 14.9-acre Special Permit project area(i.e., construction area"). Several existing structures within the Special Permit area will also be converted and/or upgraded as part of the Guest Ranch. All new construction will undergo review by the State Historic Preservation Division(SHPD)to ensure consistency with the appropriate Secretary of the Interior's Standards for Treatment of Historic Properties due to the historic nature of the Ranch. The following lists the proposed uses and development outlined in the Special Permit Application: Seven(7) Guest Ranch guesthouses for a total of 38 overnight guests per day. Conversion of"Ohana House"(currently storage) to guesthouse for overnight accommodations. Conversion of"Former Cottage Site" (currently foundation only)to guesthouse. Conversion of"Tool Shed"to ADA compliant restroom facilities for"special events" and guests. Construction of a new enclosed event space/pavilion within the 2.14-acre construction area". Development of a parking area for events. Demolition of the"Tree House" and construction of additional guesthouse for overnight accommodations—support only with full DPW permitting. Demolition of the existing pavilion. Guest Ranch to host private events for up to 100 "non-guests"on Friday or Saturday only, one(1) special event per weekend (up to 48 "special events"per year). Guest Ranch to grow and sell food, along with utilizing the certified kitchen for catering for guests, special events, and large events. Guest Ranch will offer horseback riding and other similar Ranch activities. Guest Ranch will offer equine therapy, cooking, art, and yoga classes. Guest Ranch will host two (2) "community events"per year with up to 350 people. Guest Ranch will utilize portable toilets until more permanent restroom facilities can be constructed for guests and special events. Use ofportable toilets for large events (>350 people)will continue. 2) Project Objective: The applicant's primary objective is to expand the existing Guest Ranch to provide more opportunities for guests and the community to experience and utilize a historic Guest Ranch. The project involves the conversion of existing Puakea Ranch structures, four(4) of which are currently used as vacation rentals, and the conversion/construction of three(3) additional new guesthouse structures to expand the number of guesthouses to seven(7). The applicant's secondary objective is to provide facilities that would allow for various functions including weddings and community events. The applicant's believe that obtaining the Special Permit would allow the Guest Ranch to offer activities, opportunities and events to guests, local schools, community, and senior groups to experience ranch life and learn about the history of the surrounding area,plantation life, the Paniolo, Japanese and native Hawaiian cultures that encompass the history of Kohala. 3) Staff/Employees: Puakea Ranch currently employs eight(8)part time staff, two (2) full time salary employees, and pulls from local contractors as needed. When the Guest Ranch is in full operation, an additional five(5) employees are anticipated. 4) Hours of Operation: "Guest Ranch"will be operational 24 hours/day for overnight accommodations,however, typical work hours would be between 8:00AM and 4:00PM. Event"hours: 9:00AM to 8:00PM (Sunday—Thursday) & 9:00AM to 10:00PM (Friday and Saturday). Special Events": 9:00AM to 10:00PM Friday& Saturday; 9:00AM to 8:00PM Sunday. Community Events"hours: 9:00AM to 9:00PM(Sunday) and 9:00AM to 10:00PM Friday and Saturday). 5) Property Owner(s): Christine L. Cash, James H Nelson IV, Livmar Enterprises Inc. 6) Supportive Information: The applicant has submitted the attached in support ofthe request: (Planning Department Exhibit 1 —Special Permit Application dated June 21,2020) BACKGROUND INFORMATION 7) Final Environmental Assessment: Due to the proposed Special Permit and the existing Historic Register structures, the applicant was required to comply with Chapter 343, Hawaii Revised Statutes(HRS)regarding Environmental Assessments and Impact Statements. Based on the that assessment a Finding ofNo Significant Impact(FONSI) declaration was published in the March 8, 2020 issue of the Office of Environmental Quality Control bulletin the Environmental Notice (Planning Department Exhibit 2 - Final Environmental Assessment dated February 19, 2020). 8) Notice of Violation (NOV): The Planning Department issued a Notice of Violation letter dated March 8, 2017 for alleged non-agricultural events/activities being conducted on the property. The case has been referred to the Office of the Corporation Council for their disposition. DESCRIPTION OF STATE AND COUNTY PLANS 9) State Land Use: Agricultural 10) County Zoning: Agricultural 20-acres (A-20a) 11) General Plan LUPAG Map: Important Agricultural Land(ial) 12) North Kohala Community Development Plan (NKCDP): The North Kohala Community Development Plan was adopted by the Hawaii County Council by Resolution No. 219 86 on November 3, 1986. 13) Special Management Area: The property is not situated within the Special Management Area(SMA) and is located approximately 1.4 miles from the nearest shoreline; however, the entire Island ofHawaii lies within the Coastal Zone Management area. DESCRIPTION OF PROJECT SITE AND SURROUNDING AREAS 14) Project Site: The 32.411-acre subject property is located mauka of Akoni Pule Highway approximately 2 miles south of Hawi town in the North Kohala District. The property is an operating Guest Ranch with fanning and ranching activities as well as short term vacation rental opportunities. The Guest Ranch and associated historic structures have been assigned a State Inventory of Historic Places (SIHP)number by the State Historic Preservation Division(Site No. 50-10-02-9071). The site was formally listed on the State Register of Historic Places on August 8, 2009. 15) Surrounding Zoning/Land Uses: Properties to the north, south and west ofthe subject parcel are similarly zoned A-20a, with areas of A-600a located up-slope and east of the property. Across Akoni Pule Highway from the subject parcel is a subdivision ofA-10a parcels, several of which are developed with farm dwellings. South of the subject parcel are farm dwelling structures on A-20a zoned parcels. 16) Land Study Bureau's Detailed Land Classification System: The majority of the project area is classified as "C"or"Fair" for agricultural productivity. 17) ALISH: Zone 3 or"Other Important Agricultural Lands". 18) Archeological Resources: To accompany the FEA, an archeological inventory survey AIS) of the 2.14-acre construction area was completed in October 2018. Prior archeological studies in the area indicate widespread disturbance associated with historic cattle ranching. The current AIS identified three(3) features(Nos. 7, 10.1 and 13)within the 2.14-acre"construction area"of the project site; the features consist of a modern building built over a historic concrete slab (7), a section of wall (10.1) and a newly identified concrete slab that appears to be historic in origin(13). The Puakea Ranch headquarters was previously documented and has been assigned State Inventory of Historic Places (SIHP)No. 50-10-02-9071 (Site 9071). A total oftwelve(12) features were recorded as part of Site 9071, consisting ofhouses,bunk houses, a garage, a slaughter house, a sugar mill, a series of rock walls, a network of corrals, and a saddle shop. The register data for Site 9071 indicates this site is assessed as significant under criterion"a" (associated with events), criterion"d"(association with people), criterion c"(accurate site representation) and criterion"d" for its information content. The landowner proposes minimal impacts to the 2.14-acre"construction area",however,the Features Nos. 7 and 13 (listed above)will be removed to make way for ADA improvements; Feature No. 10.1 will be preserved. 19) Cultural Resources: The accompany the FEA, a cultural impact assessment(CIA) of the Guest Ranch and more specifically the 14.9-acre Special Permit area was completed. The physical resources ofthe Puakea Ranch property, such as plants and water features, were assessed as part of the research for the EA. It was reported that no culturally important native plants, springs, groves of native trees, caves or pu'u, which may have cultural significance, were present on the subject parcel. Individuals associated with this area were interviewed to determining potential ongoing cultural resources or practices; it was determined that the only activities which occurred on Puakea Ranch in the last century were associated with cattle ranching. The assessment did not identify any individual with ties to any cultural resources or practices that would be affected by the proposed action. 20) Public Access: The subject site is situated mauka ofAkoni Pule highway, more than 1.25 miles from the shoreline. The site does not serve as a mauka-makai access to the coastline. Normal fishing and coastal access are not an issue. Additionally, as discussed above in the findings of the CIA, no traditional cultural resources, practices or properties were identified within the project area, and that the proposed usage ofthe property as a Guest Ranch would not have an adverse impact on any potential traditional cultural practices or properties located on or near the property. As such the requested use should have no adverse impacts to any type of access throughout the region. 21) Floral and Faunal Resources: A biological survey was conducted in 2018 for the subject application and Environmental Assessment(EA). The report states the property is covered by landscaped vegetation, pasture, and weedy patches. No natural vegetation was observed. All plant species observed are listed in the biological survey,however, no threatened or endangered plants species are present or would be expected on the property due to the long history of land disturbance from ranching activities. Furthermore, no plant critical habitat is present on or within three(3) miles ofthe property, with the closest plant critical habitat located above 2,000-feet elevation in the Kohala Mountains. Mammalian fauna of the subject parcel is composed mainly of introduced species associated with ranches and farms, including domestic cattle,pigs, chickens, and dogs. In addition,mongoose, feral cats,roof rats,Norway rats, and mice(all common to farms in Hawai'i) were also observed on the property. All birds seen during the survey were wide ranging non-native species such as the common myna, house finch and spotted dove. No birds indigenous to Hawai'i were identified during the survey. It is likely that the common migratory shorebird, Pacific golden plover(kolea)may be present during the winter months, as may be the Hawaiian short eared owl and Nene. No critical habitat for terrestrial fauna is present in the area, but some endangered species may overfly this and all other areas ofthe Island of Hawai`i. The Hawaiian petrel, the Hawaiian sub-species of Newell's shearwater, and the band-rumped storm-petrel have been recorded over-flying various areas on the Island of Hawai`i between late April and the middle of December each year. The Hawaiian petrel and band-rumped storm-petrel are listed as endangered, and Newell's shearwater as threatened, under both federal and State of Hawaii endangered species statutes. 22) FEMA-FIRM: Property is zoned Flood Zone X, outside of the 500-year floodplain. 23) Traffic: By letter dated January 7, 2019 the HDOT requested the preparation of a Traffic Assessment(TA)to determine trip generation, evaluate project access, and recommend improvements as needed. The TA indicated that an increase of the Guest Ranch to seven 7) guesthouses is expected to approximately increase traffic by five(5) additional round trips per day. The employee traffic would increase to be approximately ten (10)round trips per day. This combined impact represents less than 1%ofthe current traffic load on Akoni Pule Highway. The large community and wedding events represent a greater expected impact, these one day events are expected to host up to eight vendor vehicles and approximately 88 attendee vehicles, however this would represent 3.5% ofthe current traffic load on Akoni Pule Highway. No roadway or entrance improvements have been required at this time; however, it was recommended by the DPW—Traffic Division that the applicant install a streetlight at the property entrance with Akoni Pule Highway to ensure safe ingress/egress. If traffic issues attributable to the site operation are identified, the applicant will mitigate the impact to the satisfaction of HDOT, Hawai'i District Engineer. PUBLIC UTILITES AND SERVICES 24) Access: There is one access point to the parcel off the mauka side of Akoni Pule Highway which consists of a gated paved driveway. The Puakea Ranch access includes an easement to allow for shared access to the two (2)parcels mauka of the project site. Currently those two (2)lots are undeveloped. 25) Water: The site has a shared County water meter and incorporates rainwater catchment for irrigation needs. According to a letter from the Department ofWater Supply(DWS) of December 11, 2018 there is only one master meter for the nine(9)lots within the Puakea Ranch subdivision(of which Puakea Ranch is just one lot), which has averaged 5,550 gallons per day. DWS stated that it cannot provide additional water at this time for any development requiring additional water within the subdivision. Improvements to the system's source,booster pump, storage, distribution and/or transmission facilities would be required for DWS to agree to supply additional water. Based upon preliminary calculations, a conservative estimate for the average potable water demand for the proposed Guest Ranch is 5,700 gallons per day(gpd). Accordingly, to accommodate additional water demand from the Guest Ranch, the owners tentatively propose to construct a water well for domestic uses. This well is expected to incorporate an approximately 5hp submersible pump with a capacity of 35 gallons per minute. The applicant anticipates that the well will be permitted to draw up to 20,000 gpd. Fire supply would be provided in a reserve tank with an approximate storage volume of 10,000 gallons. The owners are also planning construction of a holding tank to supplement, as needed, the Guest Ranch's water needs. Additionally, to accommodate additional water demand from the Guest Ranch,the owners propose to expand the catchment capacities. The current system can collect an annual average of approximately 100 gpd. This is generated mainly from roof catchment on Yoshi's House, stored in a 20,000-gallon tank. There is also a rain barrel used to store water collected from each of the four cottages' bath houses. Additional roofs can be included in the catchment system and designed to match the low-water demand of the natural/xerophytic landscaping and the farm garden needs. With expansion, the catchment capacity could reach 400 gpd.This additional catchment supply would be provided in a reserve tank with an approximate storage volume of 10,000 gallons. 26) Wastewater System: A property of this size is allowed multiple individual wastewater systems and is large enough that these systems be unobtrusive, with no adverse effects on the property or the subsurface groundwater. The owners propose to construct a septic or enhanced septic system to address most of the wastewater requirements of the project. The primary wastewater needs will be for the proposed restrooms and additional guesthouses. The system will be designed and constructed in accordance with the requirements of the State Department of Health. In addition, portable toilets have been used and will continue to be used for infrequent, large events. 27) Police and Fire Services: Fire, police and emergency medical services are available via full-time fire and police stations located approximately 5.0 miles east of the project site. The applicant will conform to Fire Department requirements relative to the retention of adequate water storage on the site to meet fire suppression requirements. 28) Solid Waste: Per Memo dated August 14, 2020, the Department of Environmental Management(DEM) stated that a Solid Waste Management Plan shall be submitted to DEM for approval as commercial operations may not use transfer stations for disposal. To date no Waste Management Plan has been provided and the application states: "solid waste will be hauled by Puakea Ranch staff or commercial disposal operators". 29) Utilities: Electrical power is currently supplied to Puakea Ranch by HELCO via its island wide distribution network,however, a photovoltaic (PV) solar power system is installed at"Yoshi's House". Landline telephone service is also available from Hawaiian Telecom. AGENCIES COMMENTS 30) State of Hawaii Department of Transportation (HDOT): Planning Department Exhibit 3—August 14,2020 Letter. 31) State of Hawaii Land Use Commission (LUC): Planning Department Exhibit 4— August 12,2020 Letter. 32) County of Hawaii Department of Public Works (DPW), Engineering Division: Planning Department Exhibit 5—August 13,2020 Memo. 33) County of Hawaii DPW—Traffic Division: Planning Department Exhibit 6— July 31,2020 Memo. 34) County of Hawaii Department of Environmental Management(DEM): Planning Department Exhibit 7—August 14, 2020 Memo. 35) Hawaiian Electric and Light Company(HELCO): Planning Department Exhibit 8— August.16,2020 Letter. 36) County of Hawaii Fire Department: Planning Department Exhibit 9—August 25,2020 Letter. 37) County of Hawaii Department of Water Supply: Planning Department Exhibit 10— August 26,2020 Letter. AGENCIES—NO COMMENT 38) County of Hawaii Police Department: Planning Department Exhibit 11 — August 14, 2020 Letter. 39) State of Hawaii Department of Land and Natural Resources (DLNR) Land Division: Planning Department Exhibit 12—August 7,2020 Memo. 40) State of Hawaii DLNR—Engineering Division: Planning Department Exhibit 13— August 7,2020 Memo. AGENCIES—NO RESPONSE 41) State Historic Preservation Division (SHPD); State Office of Planning(OP); State Department of Health (DOH); Real Property Tax Office. PUBLIC COMMENTS 42) Planning Department Exhibit 14—August 23, 2020 Letter (Jeff Strathern) 43) Planning Department Exhibit 15—August 28,2020 email(Lisa Ebrahimi) 44) Planning Department Exhibit 16—August 28,2020 email (Marcelle Loren) 45) Planning Department Exhibit 17—August 19,2020 email(Erin Pasco) 46) Planning Department Exhibit 18—September 10,2020 email(Tern Johnston) 47) Planning Department Exhibit 19—September 11,2020 email(Groves Family) 48) Planning Department Exhibit 20—September 2,2020 email(Olivia Ebrahimi) 49) Planning Department Exhibit 21 —September 1,2020 email(Catalina Cain) 50) Planning Department Exhibit 22—September 3,2020 Letter (Bernard Moseby) 51) Planning Department Exhibit 23—August 24,2020 Letter (James F. Cash) 52) Planning Department Exhibit 24—August 28, 2020 email (Joan Channon) 53) Planning Department Exhibit 25—August 28,2020 email(Karen Johnson) 54) Planning Department Exhibit 26—August 28,2020 email(Sophia Bowart) 55) Planning Department Exhibit 27—August 28,2020 email (Alexandra Star) 56) Planning Department Exhibit 28—August 28,2020 email(Caney O'Neill) 57) Planning Department Exhibit 29—August 24,2020 email(Robert Defazio) 58) Planning Department Exhibit 30—August 28, 2020 email(Jon Adams) 59) Planning Department Exhibit 31 —August 28, 2020 email(Barbara and Bill Davis) 60) Planning Department Exhibit 32—September 3,2020 email(Virginia Fortner) 61) Planning Department Exhibit 33—August 18,2020 Letter (Robert Morrison) 140.1..0301/4144 0,...a01 $ ... ,.m, 0.0>av n..a .01..10400 ..10....w 11 NV'Id a,LIS Zia` .e onzvia,ern rr• nYiO„.:. o"zd e HIP Z90-1.00-9-9=>Iwi 1001 a l iigl 11 i IH IMVH'AMH Bind INO>IV .992-99 0N1 SJ.O31IHOHV'M'V'>I w I e1:141 Ii Ooo' 011 HONVd 3NV>IVNfidf N T' °iINV;8 HSVO 3NIjSIHHO :,,„ 20 I m W a; 20 i'l040 W O 2 r a O N goxrc U 32 EOw $ OH U 2 W o:n O w a< 0 W 2 rcx N OO0j 02 c 2a, 0°3 fn ow O 2 g 3 3 u- w O .x-o Ilam `eE o a i 2 m c ip d oo m y ,y 4 w - in, FN- z o im in fn 9 w za N iwiliggggj h!h;I Z t, z I 3 m Nw 3 a i NOEowm' L o 32 da g i g /w )) m< n i f W N j NW ew_ ff/, 42 r I I .. OW =w2W =pW 2ZWII2P,, .+ o rc i O o00rcs - f^ z gawgx o'^ xgW Zx w y"25'ornioo 9w9wsw '-^ N ^r°, On"ci omm m a 000 i Wrc ars ina o v wwm moo_ wn "'ggg 1-" 'a-1 - w ` wi'" goo m 'o"io,,,,,indu4if4iiv4icoiv4iv,aiwf4/Iy 1pNNaVIWf4/I14/ Il fnu ,L,Ap , N,I 64 dZ,H,iz :1 w8m ago r."i H gRN i `o :Pn,,, o nNN„aN:M:91?<` P27:aoazr o20! - g gig"nrnzxaoax5N 0000 Nm air a 2xxxYr2- O O 2• n,b0 w"i i5' I ,i z z J -i Jn z+o-o_ FFON nod gFina9au4 w o .Ag,rcN N o c 9 9 0 9 9 ,,aRiw-..KofOiq N n- .Agg, . mr. K is R m m m m m m mm m m m . < m I t i r 39 IIr, il m I --O O J40,,,,s„ .042.042 1 1W r I;, '- 1I4 x 1 1 - Mat ° A-......... 1e----. , _ --------- v 0 1n, i 1 ao/ i•••' p ` I . 3= pIs N D r 4 r 1 0 t . gt, U' ,' 0 1 k I • •O /10y 1 i K L 0 Cl/ J4 il I SPECIAL PERMIT REQUEST Puakea Guest Ranch 56-2864 AKONI PULE HIGHWAY L HAWI, HI 96719 TMK: (3rd) 5-6-001:082 Puakea, North Kohala District, Hawaii Island, State of Hawaii The Historic Puakea RanchrtYd1 ice C t ... ---.4.4"" La n tg r a , r L 1 Prepared for: County of Hawaii Planning Department Aupuni Center, Suite 3 101 Pauahi Street Hilo,HI 96720 JUNE 21, 2020 ening Co----- 1 I SPECIAL PERMIT APPLICATION I PUAKEA GUEST RANCH 1 TMK: (3rd) 5-6-001:082 Puakea, North Kohala District, Hawai`i Island, State of Hawai`i I I 1 I Puakea Guest Ranch Special Permit Special Permit Application Proposed "Guest Ranch" Puakea Ranch dba: Kupunakane Ranch LLC 56-2864 Akoni Pule Highway, Hawi, HI 96719 Tax Map Key: (3) 5-6-001:082 INTRODUCTION: The applicant, Puakea Ranch (dba Kupunakane Ranch LLC) intends to set an example of true sustainable, agriculturally driven and historical tourism for the island in an agricultural, rustic, historic setting. Puakea Ranch is applying for a Special Permit to enable the use of an agricultural parcel in North Kohala as the site of a Guest Ranch offering activities, opportunities I and events, such as marriages, birthday parties, anniversary celebrations, farm to fork events to guests, local schools, and local community members. Puakea Ranch sees itself as an alternative to the resorts, condos, and concrete structures that most of the visitors to Hawaii Island experience. Here, guests and the community can learn about the rich history of the ranch and the surrounding area, plantation life, the Paniolo, Japanese, Filipino, German, British, missionary and native Hawaiian cultures that make North Kohala what it is today. The subject property is within the State Land Use Agricultural District and a Special Permit from the County of Hawai'i (County) Leeward Planning Commission (Planning Commission) is required to legally undertake the Proposed Action. The Proposed Action is to allow through a Special Permit the establishment of a Guest Ranch on the property. BACKGROUND: 1 A. PROPOSED USE DESCRIPTION To fully understand the Proposed Action, some preliminary background on the property and its history are necessary. The Puakea Ranch headquarters and surrounding areas were transformed as part of Kohala's 19th century transition from traditional Hawaiian agricultural landscapes, which were integral parts of mauka-makai resource management focused around ahupua'a, to a succession of commercial agricultural ventures. Puakea Ranch began in the 1870s with Dr. James Wight, who tried sheep and sugarcane and finally focused on cattle, building a successful operation on thousands of acres that he ran until his death at the age of 91 in 1905. The ranch's boundaries grew and shrank through a series of acquisitions and amalgamations. Parker Ranch began leasing the Puakea Ranch lands from the James Wight Estate in 1932, and Richard Smart of Parker Ranch purchased its lands outright in 1946. Throughout the decades, immigrant laborers who worked in the canefields and paddocks left an indelible stamp on the landscape, which provides much of the character of the property today. For example, Zenjiro Kawamoto and his wife Wasa Watabayashi came to North Kohala from Hiroshima as part of this migration. They settled at Puakea Ranch and moved into what would eventually be called the "Cowboy House". The Kawamotos raised three children at the ranch: Masato (Johnny), Yoshio (Yoshi), and Thelma. The family went on to oversee the operations of 1 Puakea Guest Ranch Special Permit the Puakea Ranch for four generations. Yoshi Kawamoto and Parker Ranch carpenter, Mr. Yamanaka, built Yoshi's House in 1949 for Yoshi and his wife, Margaret, to raise their family. This is the original site of the grand two-story plantation house when the Wright Family Estate was still in control of the property, prior to it being leased by Parker Ranch. It is speculated that the original Plantation Manager's home, likely built in the 1870-80s, fell into disrepair and was taken down and salvaged for lumber and windows by Parker Ranch in the 1930s.111 In the 1980s, Parker Ranch sold 200 acres of the Puakea Ranch lands around the headquarters to a real estate developer, and the Kawamoto family and other ranch employees relocated. Parker Ranch discontinued ranching operations at Puakea and the homes were rented to different local families until the 200-acre property was sold for subdivision in 2002. The Puakea Ranch headquarters, including the present property and its buildings, subsequently fell into disrepair. The Puakea Ranch headquarters was purchased by Christie Cash and her partner James I I Nelson in 2006. The plan was to create a low-key, low-density family place that could be an alternative to the resorts. The owners have been working for 14 years with local archaeologists and historic preservation architects to authentically restore the homes, buildings and gardens of Puakea Ranch. Without time-consuming and expensive maintenance, there is a constant threat of dilapidation and eventual demolition. Today the ranch provides overnight vacation rental accommodations, which helps to support the property and provides the income necessary for maintenance. The restoration work not only preserves buildings but also is meant to honor the ranch and farming traditions of Puakea Ranch in an ongoing, living way. Local ranchers have used the 1 corrals for branding and roundups. The owners raise horses, cattle, and chickens, and maintain gardens and orchards as they work towards a self-sustaining homestead. The vacation rental guests enjoy experiencing the historic ranch's cowboy activities as well as learning the history of Puakea Ranch through the books, historic photographs and historic relics exhibited on the property and in the homes. In addition to its income-producing activities, the owners have made the ranch available for a variety of community events. For example, the ranch has hosted local schools for overnight excursions and docents for the Mo`okini Heiau Children's Day organized by Kumu Leimomi Lum. Puakea Ranch regularly donates overnight stays to local schools and community fundraising events, including Waimea Country School, Parker School, HPA School, North Kohala Community Resource Center, the North Kohala Hospital, Kona & Waimea Hospices and many off-island private and charter schools. The area proposed for use is 14.96 acres of the 32.411-acre property; the remaining area would continue to be used as grazing pastures, orchards, animal corrals, and open space. All new structures would be contained in an even more restricted area of 2.14 acres, in a portion of the property that will not visually affect the historic character of some of the other structures and will also minimize noise and visual disruption to neighboring properties. Additionally, extensive landscape mitigation plantings are central to the development of the designated area to block both noise and views to the area from surrounding properties. The Guest Ranch would be able to accommodate as many as 38 visitors in the seven rental units and the event area, an increase from the current occupant capacity of 18. It would host group activities such as weddings and family reunions, which would be accommodated in a new event area established to accommodate parking, temporary tents and portable toilets. 1 2 Puakea Guest Ranch Special Permit Additionally, the Tree House is currently used and would continue to be used as a farm dwelling for the owner and caretaker. Within the special permit application that structure would be proposed to convert to a guest unit and plans to permit that structure or replace it would proceed once granted the special permit. The maximum number of persons on property at any given time for guest events will be limited to 100 outside guests(with two events a year at 350 people). Events with more than 38 attendees will be limited to Friday, Saturday and Sunday and will involve utilization of port-a- potties. Event hours will be limited to 9am-8pm (Sunday- Thursday) and 9am-10pm (Friday and Saturday). The current no-noise policy after 10pm will continue. Any amplification devices will be restricted to State standards for residential uses at all property lines. Hawaii Administrative Rules (HAR), Title 11, Chapter 46, "Community Noise Control" establishes maximum permissible sound levels in dBA according to zoning districts. Residentially zoned land is considered Class A as provided in section 11-46-3. Class A requires the lowest maximum permissible sound levels. For comparison, Agriculturally zoned land is considered Class C and allows for the highest maximum permissible sound levels. The Guest Ranch would include a certified kitchen to allow catering for guest events and other special events. Guest amenities would include the existing swimming pool and poolside pavilion. Horseback riding and self- guided ranch tours would also be available. In addition to its everyday function as a guest ranch for visitors, the Puakea Guest Ranch will host private events for non-guests; grow and sell food and utilize the certified kitchen for catering; offer horseback riding, equine therapy, cooking, art, and yoga classes; and host 111communityactivitiesandfunctionssuchascommunitypancakes & kites festival, senior functions, community fundraising events and local school functions. As with guest events, event hours will be limited to 9am-8pm (Sunday-Thursday), 9am-10pm (Friday and Saturday). The Puakea Guest Ranch would also like to host up to two (2) community events annually that will allow up to 350 guests. For these community events, event hours will be limited to 9am- 9pm (Sunday), 9am-10pm (Friday and Saturday). Puakea Ranch currently employs a crew of eight part time staff (up to 20 hours per week), two full time salary employees and a host of local outside contractors island wide. Four of the jobs are agriculturally related: gardener, grounds keeping, horse wrangler. The goal is to continue to plant lavender, pineapple, dragon fruit and other small, specialty crops and employ additional local community members to support agricultural and tourism business. BACKGROUND: B. PROPERTY DESCRIPTION The 32.411-acre subject property is designated by TMK (3) 5-6-001:082 and is located mauka of Akoni Pule Highway (State Highway 270) several miles south of Hawi town, in the district of North Kohala (Figure 1). The property is owned by Christine L. Cash and James H. Nelson, IV and Livmar Enterprises, Inc., who are requesting a Special Permit for use of the property, which is a collection of cottages, gardens and other structures listed on the State Register of Historic Places, as a Guest Ranch. The Proposed Action would continue the vacation rentals and construct facilities that would allow for various functions including weddings and community events. It would involve adaptation of existing Puakea Ranch structures, four of which are 3 Puakea Guest Ranch Special Permit currently used as vacation rentals, construction of new structures and implementation of mitigation measures. Ranching and gardening uses of the property would continue and expand. I Figure 1. Location Map J1 ,;-Map Location L, HONOKAA I WAIMEA s I F.--1, r A if-r1---I-- itKAILUA HILO te` 1, krr,`" a/p`k„,... 4KEALAKEKUA P OA r--\,/ PAHALA i Ilk •S' ctl ' P'( Tares AALEHU1 N , . r_ 0 = > N- A C 14N N . el c 44 ON k I 46:. 31, .. ,,.. q);.***-ss-'----:---'-- 6.. 2 \4 7 r- , \‘,-7-..„. „_____ 7._ „Ali er 1 --"/'— '-' [ r . cif-:,,, I Cern gem _ A a Gf ,' / j 3 4/ j...,"-.\° 11.4'itt. fi,,,o, '' tft 4 ,....4'S, Special Use permit area n -,, 5 it . 1% M maM . Mir l `/lam ratl w 1 4 Puakea Guest Ranch Special Permit The area was informally recorded by the landowners in a June 2009 National Register of Historic Places form. The ranch buildings were subsequently assigned the State Inventory of Historic Places (SIHP) number 50-10-02-9071 by the State Historic Preservation Division SHPD). The current extent of the ranch is depicted in Figure 2. The buildings consist of the following: The Saddle House, James Cottage (built 1920s), The Cowboy House (1880s), The Toy Box, The Tool Shed, The Chicken Coop, The Tree House, Yoshi's House (1940s) and Miles Away (1930s). The site was formally listed on the State Register of Historic Places on August 8, 2009. A list of all existing and future structures and other facilities under the Proposed Action is contained in Table 1 and illustrated on the Site Plan (Figure 3). Figure 2. Current Layout of Puakea Ranch Property I f R I 1 IIUVAi' }FATE 1 0,[SAPRI 110,11 [ r x tY"., fI13;'1 r fig, . w hfJjW1<C4ETApLE C1ArtpEN t[Mv[ „ 4 y uhf x Bqy1O} 4 1.,. 1 lM Cowear Hwfe c 188 1 r Y Y S:BcMl .KOMO Ms.P s 4101*. r,;?.: m.. arm' I i In s eouoA v „, r;/wr OaAwH rt 444 q+ ,' .—.. d C4fa6n/ e R[N(oc AVAALV-taHE I [tom er r ti,"1 l Y[-' /°II ti NAtiVC NAWM ANTb[Vv fSt G,[Cf iNr5E I I Uc.toq s L P? ., 1` ' € 4 1o I<,!,(j OA IW{ . CVIl ` 5+, w tAKCAWX r. 1 b 4 JANEems ..a .. l s.-.zr xs :s 5 ii V / / a 4' 2':- T. i'2' h7m 1 0' ) w z I 0fgWw v w o o¢ D. oh 5D ZO Ho 6 ahaT o o lig fill/ 4. I tOW, 1IOw O 3 0. N 0. O C CO 16 b'pt,- a o CC lD LI Chi LL i / I °- _ 4'„ 7h.! gl 6 '/ 'iF /// 23 41 0 / g jJ f _ m At" ti I y4". 4,;,,,,,F `'; it R 7 dal, ,(. / w j';. F' . r.o- :y;Ng!{t I --44...z...,/ / l$ 88w";.s':;. i%fg- ` %''' J k t :;; X41\ Q.:..., ,:, `: II\l');-*-- -----..----,..„ g 4 Mama' r` \ 9$_ry g a fiV. o '_ a o V/// w=r . 8- I' T O N O I!1 OO/ 3O0! am=3 c ori fro ?3 (13 0Q< rD fDro ,7o o, 0 •NS N O O u S-.0o N NQt. < N2Do- -t v)=4so,, Dos m CD al rD `Du o< - ci N V7 rD aNr• rDro 7 Tz rte+ O co pT T ppT, O O C n•7 rD OJ OJ Ol r-O O Ui Ul !A Gl N Q 7 E L =R a' , C O RI r* rt r1. 17 T c 4j ] g 0 -"lar O O O O7 O COQT IA -NC c c c < C 7 N a 0 Ol rD rD co =rD n ft) 01 — r•' "7"‹K O O K 3 0 3 0c 7 rD N`< C m° a.8,saNcG1 al VI 3 c G1 G1G1G1p G1°- T N o N rCD rCD N N O rCD c cc-m`717‹ r2. zzz -, ° 000 >m4. 4.4.4. 0.4• r xo mmr'oDp0000'o c1 m " r Ln to cn in iCn O in v c 1' m m m rD v D. NO r cc030fDasr330cn a. % rD O 50. TA rt nIIC N 3 reO 7. m z z c c c z c E m m r Z r4D n N O O N D/ D1 0 N N N N N O N CO C L 7 LO NJ- N ~03 N~r NF+ 0 0?.OO co.J Y •N •V lG N t0 W O A 5 LI 000 0 -O-0 Q1 LID CN M CA 7nn Z N/Z Z 2 N rlD N N N l N F : 10ONN0OONNNNNNNN 00. CI N N• O N G_1 N N 0 0 J coco "IO 3 0 Ti aca Or OO A-7 CU o_i N AAN O1AZ 01 ID N Puakea Guest Ranch Special Permit 16 BACKGROUND: C. STATE AND COUNTY PLANS IThe subject site falls outside the Special Management Area. The County of Hawaii Planning Department determined that because the Proposed Action occurs within a site on the State Historic Register, an Environmental Assessment (EA) pursuant to Chapter 343, Hawaii Revised I Statutes (HRS) is necessary. This EA process was conducted in accordance with HRS Chapter 343, along with its implementing regulations, Title 11, Chapter 200.1, of the Hawaii Administrative Rules (HAR). The Planning Department, acting as the approving agency, I concluded after considering the comments to the Draft EA that no significant impacts would be expected to occur and issued a Finding of No Significant Impact (FONSI). A copy of the final EA published in The Environmental Notice on March 8, 2020 is available for viewing at: I http://oeq_c2.doh.hawaii.gov/EA=EIS_Library/2020-03-08=HA-FEA-Puakea-Guest-Ranch.pdf) Hawai'i State Plan I Adopted in 1978 and last revised in 1991 (Hawai'i Revised Statutes, Chapter 226, as amended), the Plan establishes a set of themes, goals, objectives and policies that are meant to guide the State's long-run growth and development activities. The three themes that express the basic purpose of the Hawaii State Plan are individual and family self-sufficiency, social and economicImobilityandcommunityorsocialwell-being. The Proposed Action would promote these goals by allowing a land use that would take advantage of and help maintain a historic resource, provide employment, and continue and improve a venue for community events, while generating I only negligible environmental impacts, thereby enhancing quality-of-life and community and social well-being. I Hawaii State Land Use Law All land in the State of Hawai'i is classified into one of four land use categories — Urban, Rural, Agricultural, or Conservation — by the State Land Use Commission, pursuant to Chapter 205, I HRS. The property is in the State Land Use Agricultural District. Only with the granting of a Special Permit by the County of Hawaii Leeward Planning Commission would the Proposed Action be consistent with this classification. LCounty of Hawaii Zoning and General Plan County of Hawaii Zoning. The entire property carries a zoning designation of A-20a I Agricultural, 20-acre minimum lot size). With the granting of a Special Permit by the County of Hawai'i Leeward Planning Commission, the Proposed Action would be consistent with this classification. The County of Hawaii General Plan Land Use Pattern Allocation Guide (LUPAG). The LUPAG map component of the General Plan is a graphic representation of the Plan's goals, policies, and standards as well as of the physical relationship between land uses. It also establishes the basic urban and non-urban form for areas within the planned public and cultural facilities, public utilities and safety features, and transportation corridors. The property, along with all surrounding property within a mile or more, is classified as Important Agricultural Lands in the I p LUPAG. Given the granting of a Special Permit by the County of Hawaii Leeward Planning Commission, the Proposed Action would be consistent with this classification. North Kohala Community Development Plan: The North Kohala Community Development Plan encompasses the judicial district of North I8 t Puakea Guest Ranch Special Permit r. Kohala and was developed under the framework of the February 2005 County of Hawai'i General Plan. Each Community Development Plan (CDP) is intended to translate broad General Plan Goals, Policies, and Standards into implementation actions as they apply to specific geographical regions around the County. CDPs are also intended to serve as a forum for community input into land-use, delivery of government services and any other matters relating to the planning area. The General Plan now requires that a Community Development Plan shall be adopted by the County Council as an "ordinance," giving the CDP the force of law. This is in contrast to plans created over past years, adopted by"resolution" that served only as guidelines or reference documents to decision-makers. In November 2008, the North Kohala CDP was adopted by the County Council. The purposes of the North Kohala CDP are to: Articulate North Kohala's residents' Vision and Values for their Community Identify North Kohala's residents' Priority Issues to be addressed by the CDP Develop Strategies and Action Programs to address those Priority Issues The CDP, with a theme of"Keep Kohala, Kohala," describes the district as a"Cultural and Historical Preservation Community" and emphasizes that all development decisions "shall be required to assess and disclose their potential impact on cultural sites and resources within the district, and shall be in keeping with the heritage and culture of North Kohala." The Puakea Guest Ranch is a key component of preserving a vital part of Kohala's architectural heritage in a functioning state. 3 The CDP states that its goal is: To manage the future growth of the district in a manner that is consistent with the Kohala I lifestyle and ideals of being a rural community with a strong cultural heritage, an agricultural base, and a small town feel. 1 That overall goal is expressed through four Priority Issues, each with its own Goal. The Puakea Guest Ranch project is compatible with Priority Issue 1 and its Goal - Growth Management. Under the CDP growth is to be directed "to areas within and near existing town centers in order to preserve the district's open space and cultural resources; and to promote agriculture." Other priority issues are Access—to provide for community access to mauka and makai 1 resources; Affordable Housing —to provide affordable housing for the district's residents; and Infrastructure and Community Facilities— to update Kohala's infrastructure systems that are aging or in disrepair, and provide infrastructure, community facilities, and services that adequately serve the community on an on-going basis, and especially in times of emergency. The Puakea Guest Ranch is not inconsistent with these priority issues. Many of the goals, policies and strategies of the CDP involve strictly government actions or actions that do not relate to the property and the type of activities. One relevant strategy is the following: Strategy 1.9: Establish a View Plane Protection Program to identify and protect areas of significant beauty along the Kohala Mountain Road and Akoni-Pule Highway corridor. INoaspectoftheProposedActionwouldadverselyaffectanyviewplane. 9 Puakea Guest Ranch Special Permit IBACKGROUND: D. DESCRIPTION OF SURROUNDING AREAS IThe North Kohala District is primarily residential in nature, with some ongoing farming and ranching. Commercial activities bolstered by tourism occur in its two primary towns, Hawi and Kapa'au. Over the decades, several subdivisions have occurred, including Puakea Ranch, I Puakea Bay Ranch, and The Ranch at Puakea. These neighborhoods of large agricultural lots surround the subject parcel. Even larger agricultural parcels surround these subdivisions. IBACKGROUND: E. FIRM DESIGNATION AND HAZARDS The Federal Emergency Management Agency's Flood Insurance Rate Map (FIRM) 1551660128C (9/16/1988) indicates that the property is in Flood Zone X, outside of the 500- year floodplain (http://gis.hawaiinfip.org/FHAT/ accessed January 2019). The project area has no named perennial or intermittent freshwater bodies, with the nearest Ifeature being Lipoa Gulch approximately two miles east in Hawi. No significant ephemeral drainages are present on or near the property. Maps printed by the Pacific Tsunami Warning Center and the County of Hawaii Civil Defense I Agency indicate that the property is about a mile mauka of the zone that should be evacuated during a tsunami warning, which in the Puakea area are well makai of Akoni Pule Highway https://tsunami.coast.noaa.gov/#/Accessed January 2019). I BACKGROUND: F. ARCHAEOLOGICAL RESOURCES To accompany the EA, an archaeological inventory survey (AIS) of the 2.14 acres within which ground disturbance would occur was prepared by Haun and Associates conducted in October I2018. The survey is included in Appendix 2 and briefly summarized here. As discussed previously, as part of historic preservation efforts, the owners recorded the Puakea Ranch headquarters in a June 2009 National Register of Historic Places form (NRHP), and the ranch buildings were subsequently assigned State Inventory of Historic Places (SI HP) number 50-10-02-9071. The portion of Site 9071 in the archaeological survey project area ispiassociatedwiththehistoricuseofthePuakeaRanch. The AIS identified within this 2.14-acre area three features (Features 7, 10.1 and 13) of this previously identified historic site. The AIS contains photographs, measurements and other descriptions of these features. The features consist of a modern building built over a historic concrete slab (Feature 7), a section of the Feature 10 wall, designated as Feature 10.1, and a newly identified concrete slab that appears to be historic in origin. (Feature 13). The Feature 7 slab originally functioned as the foundation I for a garage and has been repurposed for use as a tool shed. The Feature 10.1 wall is interpreted as a livestock control feature likely used to prevent livestock from entering habitation areas. The original function of the Feature 13 slab is unknown; however, it currently functions as pi the foundation for a chicken coop and farm stand. The portion of the site in the project area is altered and in fair condition. 10 ii p Puakea Guest Ranch Special Permit 1 n in fair condition. The previouslyTheportionofSite9071intheprojectareaisunalteredandapy prepared NRHP form indicates Site 9071 is assessed as significant under criterion "a" because of its association with events that made a contribution to the broad patterns of history (sugar cane cultivation and cattle ranching), under criterion "b" due to its association with Dr. James Wight, under criterion "c" as an excellent site type example, and under criterion "d" for its information content.1 Site 9071 was determined eligible for inclusion in the National Register of Historic Places. The proposed development will have an effect on the historic properties within the project area. The landowners propose minimal impacts to the 2.14-acre project area, consisting of constructing an approximately 2500-square foot space that contains an Americans with Disabilities Act (ADA) approved restroom, kitchen facility and a space for set up in an enclosed area. The majority of the area will not be impacted by the proposed development and will function as an open event area for weddings and other functions; however, the Feature 7 and 13 slabs will be destroyed to make way for the ADA improvements. The Feature 10.1 wall will be preserved. The Feature 7 and 13 slabs are not integral components of the Puakea Ranch and functioned as minor elements of the facility. In order to mitigate their destruction, the proposed restroom will be designed in accordance with the Secretary of the Interior's Standards for rehabilitation which is defined as "...the process of returning a property to a state of utility, through repair or alteration, which makes possible an efficient contemporary use while preserving those portions and features of the property which are significant to its historic, architecture, and cultural value." NPS.gov.) The restroom will be aesthetically compatible with the other historic structures on the property, constructed with board and batten siding and corrugated metal roofing. The restroom will be constructed in such a manner that if removed in the future, the essential form and integrity of the remaining historic properties and its environment would be unimpaired. BACKGROUND: 1 G. FLORAL AND FAUNA To accompany the EA, a biological survey was conducted in 2018 by Ron Terry, Ph.D. The final 1 version of the biological survey was included in EA (Section 3.1.4) and briefly summarized here. The property is covered by landscaped vegetation, pasture and weedy patches. No natural vegetation exists. All plant species observed are listed in the biological survey. Only a few common native plants— the common roadside herb `uhaloa (Waltheria indica), some planted specimens of hapu'u tree ferns (Cibotium glaucum), and the common morning glory (Ipomoea indica) — were noted on the property. No threatened or endangered plant species (USFWS 2018) are present or would be expected on the property. Furthermore, no plant critical habitat is present on or within three miles of the property, with the closest plant critical habitat above 2,000 feet in elevation in the Kohala Mountains. (https://ecos.fws.gov/ecp/report/table/critical- habitat.html). The mammalian fauna of the project area is composed mainly of introduced species associated with ranches and farms, including domestic cattle, pigs, chickens and dogs. In addition, wild mammals include small Indian mongooses (Herpestes a. auropunctatus), feral cats (Felis cattus), roof rats (Rattus r. rattus), Norway rats (Rattus norvegicus), European house mice (Mus 11 Puakea Guest Ranch Special Permit domesticus) and possibly Polynesian rats (Rattus exulans hawaiiensis). None of these mammals are of conservation concern and all are deleterious to native flora and fauna. All birds seen on the site during the biological reconnaissance were wide-ranging aliens such as common myna (Acridotheres tristis), house finch (Carpodacus mexicanus), cattle egret Bubulcus ibis), spotted dove (Streptopelia chinensis), yellow-billed cardinal (Paroaria capitata), saffron finch (Sicalis flaveola), gray francolin (Francolinus pondicerianus) and zebra dove Geopelia striata). No birds indigenous to Hawai'i were identified during the survey. However, it is likely that the common migratory shorebird, Pacific golden-plover or kolea (Pluvialis fulva) is present during the winter on mown areas, as it commonly is throughout the State of Hawai'i. The occasional presence of the Hawaiian short eared owl (Asio flammeus sandwichensis) and Nene (Branta sandvicensis) have been reported. They are found in the majority of the island. There is no aspect of the project that would affect them in any adverse way. No critical habitat (https://ecos.fws.gov/ecp/report/table/critical-habitat.html) for terrestrial fauna is present in the area, but some endangered species may overfly this and all other areas of the Island of Hawaii. The Hawaiian petrel (Pterodroma sandwichensis), the Hawaiian sub-species of Newell's shearwater (Puffinus newelli), and the band-rumped storm-petrel (Oceanodroma castro) have been recorded over-flying various areas on the Island of Hawai'i between late April and the middle of December each year. The Hawaiian petrel and band-rumped storm-petrel are listed as endangered, and Newell's shearwater as threatened, under both federal and State of Hawaii endangered species statutes. These seabirds hunt over the ocean during the day and fly to higher elevations at night to roost and nest. The Hawaiian petrel and the band-rumped storm petrel are known to nest at elevations well above 5,000 feet on the Big Island, not within the project area. But during it breeding season from April through November, the Newell's shearwater burrows under ferns on forested mountain slopes. These burrows are used year after year and usually by the same pair of birds. Although capable of climbing shrubs and trees before taking flight, it needs an open downhill flight path through which it can become airborne. Once abundant on all the main Hawaiian Islands, most Newell's shearwaters are today found in the steep terrain between 500 to 2,300 feet on Kauai (https://www.fws.gov/pacificislands/fauna/ newellsshearwater.html). BACKGROUND: H. VALUED CULTURAL RESOURCES To accompany the EA, Haun and Associates conducted a cultural impact assessment (CIA) of the operations of the Guest Ranch, focused specifically on the 14.92 acres of the property that would be used for that purpose. The objective of the assessment was to identify any culturally significant resources or traditional cultural practices that occur within the property and its immediate vicinity. The assessment utilized archival research with historical documents, previous archaeology studies, previous cultural impact assessment reports, and oral interviews. The CIA is included as Appendix 3 and provides a wealth of information on the history of Puakea Ranch and related topics for interested readers including a summary on the pre- Western agriculture context of the property, the transformation to agricultural and ranching uses, the question of ongoing cultural resources and practices, and the potential to impact such resources by operating a Guest Ranch. 12 Puakea Guest Ranch Special Permit The Constitution of the State of Hawaii clearly states the duty of the State and its agencies to preserve, protect, and prevent interference with the traditional and customary rights of native Hawaiians. Article XII, Section 7 requires the State to "protect all rights, customarily and traditionally exercised for subsistence, cultural and religious purposes and possessed by ahupua'a tenants who are descendants of native Hawaiians who inhabited the Hawaiian Islands prior to 1778." In spite of the establishment of the foreign concept of private ownership and Western-style government, Kamehameha III (Kauikeaouli) preserved the people's traditional right to subsistence. As a result in 1850, the Hawaiian Government confirmed the traditional access rights to native Hawaiian ahupua'a tenants to gather specific natural resources for customary uses from undeveloped private property and waterways under the Hawaii Revised Statutes (HRS) 7-1. In 1992, the State of Hawaii Supreme Court reaffirmed HRS 7-1 and expanded it to include, "native Hawaiian rights...may extend beyond the ahupua'a in which a native Hawaiian resides where such rights have been customarily and traditionally exercised in this manner" (Pele Defense Fund v. Paty, 73 Haw.578, 1992). The duty of agencies when granting land use permits to identify valued natural, cultural and historical resources, assess impacts to them and devise feasible actions to reasonably protect native Hawaiian rights was established by the Hawai'i Supreme Court in the case of Ka Pa'akai 0 Ka 'Aina vs. the Hawaii State Land Use Commission (94 Hawaii 31, 7 P.3d 106, 2000). To assist in consideration of cultural resources and their impacts during the EA/EIS process, the Hawaii State Office of Environmental Quality Control (OEQC) developed the Guidelines for Assessing Cultural Impacts (http://health.hawaii.gov/oegc/). The types of cultural practices and beliefs subject to assessment may include subsistence, commercial, residential, agricultural, access-related, recreational, and religious and spiritual customs. A finding of a cultural impact assessment is to evaluate the probability of impacts on identified cultural resources, including values, rights, beliefs, objects, records, properties, and stories occurring within the project area and its vicinity. The physical resources of the Puakea Ranch property, such as plants and water features, were assessed as part of the research for the EA. In general, it was observed that no culturally important native plants, springs, groves of native trees, or caves or pu'u, which may have cultural significance, are present on the property. In order to determine what cultural associations the property had beyond such physical features, and whether there were any ongoing cultural resources or practices, archival research was conducted at the Hamilton Library Hawaii and Pacific Collection at the University of Hawaii-Manoa, the University of Hawaii-Hilo Hawaiian Collection, the Land Survey Office and the Archives Division of the Hawaii Department of Accounting and General Services, the Bishop Museum Archives, State Historic Preservation Division Library, State Survey Division, and the Hawai'i State Public Libraries in Honolulu and Hilo. Most importantly, informal "talk story" interviews were conducted with knowledgeable individuals in a manner that allowed them to discuss the issues most important to them about the project area and the Proposed Action. The individuals who chose to participate in this CIA were residents of Kohala. A number of people were familiar with the property and its resources. Puakea Ranch and its vicinity were used by Parker Ranch for more than 70 years. Masa Kawamoto was born and raised on the ranch and would often help his mother as she worked around the ranch. He recalled that he would often go bird hunting with his brother to help his mother whenever the ranch owners would throw parties. Farming and bird hunting were traditional activities practiced by the local ranch families. Michael Gomes, a local historian and author, stated that the only 13 IPuakea Guest Ranch Special Permit Iactivities that took place on Puakea Ranch were associated with cattle ranching. Those activities ceased at Puakea Ranch once Parker Ranch sold its Puakea holdings and the families were asked to leave. No individual identified any cultural resources or practices that would beIaffectedbytheProposedAction. Based on all these sources, the CIA concluded that no traditional cultural resources, practices or properties were identified within the project area, and that the proposed usage of the property as a Guest Ranch would not have an adverse impact on any potential traditional cultural practices or properties located on or near the property. I BACKGROUND: II. PUBLIC ACCESS The subject site is situated mauka of the highway, more than 1.25 miles from the shoreline. The I site does not serve as a mauka-makai access to the coastline. Normal fishing and coastal access is not an issue. Additionally, as discussed above in the findings of the CIA, namely that no traditional cultural resources, practices or properties were identified within the project area, and that the proposed usage of the property as a Guest Ranch would not have an adverseCimpactonanypotentialtraditionalculturalpracticesorpropertieslocatedonornearthe property. As such the requested use should have no adverse impacts to the recreational resources of the area. t BACKGROUND: 1 P J.ROADWAY ACCESS Puakea Ranch takes access from a driveway off the east (mauka) side of Akoni Pule Highway II State Highway 270), a facility under the control of the Hawaii State Department of Transportation (HDOT). The highway is signed for 55 MPH in the area. The west side of the intersection also accesses on the Puakea Bay subdivision, a private gated community with 42 lots. No intersection controls, turn lanes, storage lanes or acceleration lanes are present. With t current low traffic levels and minimal peak hour use, there appears to be no traffic issues during normal operation. For an event with more than 100 people attending, professional traffic control pis utilized to facilitate free flow of vehicle access through the project entrance. Any legal access rights shared through this entrance will not be hindered. III BACKGROUND: K TRAFFIC IMPACTS IThe Proposed Action would increase traffic during normal operation by a factor of about two with a concomitant increase in employee and service trips. IIn a letter of January 7, 2019 (see Appendix 1), the HDOT requested preparation of a Traffic Assessment by a licensed professional engineer to include trip generation, an evaluation of the project access, and recommend improvements as needed. 14 I Puakea Guest Ranch Special Permit I Traffic Assessments are often conducted for projects to determine if the proposed action may produce significant traffic impacts. Section 25-2-46 (Concurrency Requirements), County of Hawai'i Zoning Code, for example, requires a traffic impact analysis report (TIAR) with the application for any zoning amendment which can generate 50 or more peak hour trips. To compare the scale of impacts of the minimum sized subdivision that triggers the need for a TIAR under the County Code, an engineer assessed the traffic generation characteristics of the Proposed Action to accompany the EA. This Traffic Assessment Report is included as 1Appendix4. The trip generation methodology used is based upon applications developed by the Institute of Transportation Engineers (ITE) and published in "Trip Generation Manual", 9th Edition, 2012. Trip generations have been developed for a variety of land uses (or facility types) that correlate trips with dwelling units, area, population, vehicle ownership and intensity of use. Each facility type has a catalog Classification number for identification purposes. For any given classification, repeated field studies by the ITE measuring actual trips generated by different land uses has calculated a generator factor for peak hour trips. This factor is multiplied by the number of units in a land use This is further divided into trips that are entering or exiting the development, a split that differs by time of day. In this case, the published dataset does not have good data for the type of use anticipated. In order to approximate a Classification it was necessary to estimate daily trips based upon the expected staffing levels and the maximum attendance allowed by capacity. To increase the Guest Ranch to seven rental units, the guest traffic is expected to approximately increase by five round trips per day. The employee traffic would increase to be 10 round trips per day. This combined impact represents less than 1% of the current traffic load on Akoni Pule Highway.I The large community events represent a greater expected impact. These one-day events are to be limited to one or two per year. An event like this is expected to host up to eight vendor vehicles and approximately 88 attendee vehicles. These round trips focused on only one or two days per year only represent 3.5% of the current traffic load on Akoni Pule Highway. The relatively minor increase due to this project related traffic is not expected to have any significant impacts to Akoni Pule Highway due to the low volume of employees and guests that would access the site. The applicant believes that any potential for project-induced secondary effects on Route 270 traffic safety during hosted events can be handled through the use of professional traffic control personnel on the very few occasions where large numbers of vehicles are expected. If traffic issues attributable to the site operations are identified, the owners will mitigate the impact to the satisfaction of HDOT, Hawaii District Engineer. BACKGROUND: I L.UTILITIES Electrical power is already supplied to Puakea Ranch by Hawai'i Electric Light via its islandwide 1 distribution network. Landline telephone service is also available from Hawaiian Telcom. There is photovoltaic (PV) solar power installed at Yoshi's House. 15 t IPuakea Guest Ranch Special Permit IThe site has a shared County water meter and incorporates rainwater catchment for irrigation needs. According to a letter from the Department of Water Supply (DWS) of December 11, 2018 I see Appendix 1), there is only one master meter for the nine lots within the Puakea Ranch subdivision (of which Puakea Ranch is just one lot), which has averaged 5,550 gallons per day. DWS stated that it cannot provide additional water at this time for any development requiring additional water within the subdivision. Improvements to the system's source, booster pump, I storage, distribution and/or transmission facilities would be required for DWS to agree to supply additional water. Based upon preliminary calculations, a conservative estimate for the average potable water demand for the proposed Guest Ranch is 5700 gallons per day (gpd). i Accordingly, in order to accommodate additional water demand from the Guest Ranch, the owners tentatively propose to construct a water well for domestic uses. This well is expected to incorporate an approximately 5hp submersible pump with a capacity of 35 gallons per minute. The applicant anticipates that the well will be permitted to draw up to 20,000 gpd. Fire supply would be provided in a reserve tank with an approximate storage volume of 10,000 gallons. L Then, too, the owners are also planning construction of a holding tank to supplement, as needed, the project's water needs. Additionally, in order to accommodate additional water demand from the Guest Ranch, the owners propose to expand the catchment capacities. The current system is capable of collecting an annual average of approximately 100 gpd. This is generated mainly from roof catchment on Yoshi's House, stored in a 20,000 gallon tank. There is also a rain barrel used to store water I collected from each of the four cottages' bath houses. Additional roofs can be included in the catchment system and designed to match the low-water demand of the natural/xerophytic landscaping and the farm garden needs. With expansion, the catchment capacity could reach L 400 gpd. This additional catchment supply would be provided in a reserve tank with an approximate storage volume of 10,000 gallons. The site also is exploring access to water from the Kohala Ditch, however it is in no way being counted on. If available, this source would allow I up to 2500 gpd, to be used for farming purposes. A property of this size is allowed multiple individual wastewater systems and is large enough that these systems be unobtrusive, with no adverse effects on the property or the subsurface groundwater. The owners propose to construct a septic or enhanced septic system to address the majority of the wastewater requirements of the project. The primary wastewater needs will P be for the proposed restrooms. The system will be designed and constructed in accordance with the requirements of the State Department of Health. In addition, portable toilets have been used and will continue to be used for infrequent, large events. This is an economical way to handle surge loads and ensure that the septic systems will not be burdened by large event use N that may happen only once or twice a year. This is a common practice on island and there are several portable toilet providers to consistently obtain from, when needed. The provider selected will advise on the rental supply based upon the expected number of guests and the duration of the event. Typically only two to four portable toilets are required for the large events. P 16 Iii I Puakea Guest Ranch Special Permit CRITERIA: 1 A. CONSISTENCY WITH CHAPTER 205A, COASTAL ZONE MANAGEMENT The objectives of the Hawaii Coastal Zone Management (CZM) Program are outlined in Chapter 205A, Hawaii Revised Statutes. The principal goal of the CZM program is to assure the protection and maintenance of the State's coastal resources. Although the entire State falls within the CZM area, the proposed project is not within the Special Management Area. Nevertheless, a review of the project's consistency with CZM policies is required. The proposed project is located at over 550 foot elevation and is over 6,700 feet from the North Kohala shoreline. All improvements will be done to conform to the requirements of the Department of Health. The project will have no impact on coastal resources more than a quarter of a mile away. It will also have no impact on coastal views or scenic resources. The project will involve the re-use of existing structures and will seek to preserve scenic views and the character associated with the rural landscape that surrounds the property. Public participation goals associated with CZM goals will be met through the public hearing processes to be conducted before the Planning Commission for the review of this project. CRITERIA: B. IMPACTS ON SURROUNDING PROPERTIES The maintenance of Puakea Ranch has many positive impacts for the North Kohala community in the form of a venue for community events and a source of jobs and civic pride in the historic preservation. At the same time, several neighbors who have built homes in and near the subdivision on lots ranging from 14 to 30 acres have voiced complaints about existing activities and concerns about continued activities and expansion. The concerns appear to be primarily related to noise, but fire hazard, strangers in the neighborhood, traffic and incompatibility with agriculture have also been raised. The surrounding properties are utilized for agricultural and residences on large acreage parcels. The Applicant does not foresee any significant impacts on surrounding land owners beyond the relatively minor increase of project related traffic which is not expected to have any significant impacts to Akoni Pule Highway due to the low volume of employees and guests that would access the site as discussed above. The Guest Ranch would not be expected to have more than a negligible impact on air quality during the minor scale of construction or during operation. Dust is an occasional nuisance here and in any other windy area of the drier parts of North Kohala, but the Guest Ranch would not produce any greater impacts than those associated with normal ranching activities, and usually considerably less. In terms of scenic impacts, there will be little change to the appearance of the property from any public vantage point, and no adverse impacts on view planes or scenic sites protected by County plans. Any construction in the event area will include light grading, trenching and frame construction involving small-scale heavy equipment, compressors, and power tools. These activities have the 17 Puakea Guest Ranch Special Permit potential to generate noise exceeding 95 decibels at times, impacting nearby sensitive noise receptors on the margins of the development. Most construction will occur several hundred feet from the property boundaries. No sensitive noise receptors such as homes, parks or schools are present within 750 feet; only two homes outside the property are within 1,000 feet. In the State of Hawaii, whenever construction noise is expected to exceed the DOH's "maximum permissible" property-line noise levels, contractors are required to consult with DOH per Title 11, Chapter 46, HAR (Community Noise Control) prior to construction. DOH then reviews the proposed activity, location, equipment, project purpose and timetable in order to decide whether a permit is necessary and what conditions and mitigation measures, such as restriction of equipment type, maintenance requirements, restricted hours, and portable noise barriers, will be necessary. It is proposed that the contractor be required as part of Special Permit conditions to consult with the DOH prior to the start of construction to determine whether mitigation would be required. On a permanent basis, future legal uses of the property as a Guest Ranch will generate some level of noise, particularly during large events. Excessive noise for past events has been cited by some neighbors as a concern. The owners have responded to this concern as part of the design of the Proposed Action by relocating certain features and proposing time restrictions. The maximum number of persons on property at any given time for guest events will be limited to 100 outside guests (with two events a year at 350 people). Events with more than 38 attendees will be limited to Friday, Saturday and Sunday. Event hours will be limited to 9am- 8pm (Sunday- Thursday) and 9am-10pm (Friday and Saturday). The current no-noise policy after 10pm will continue. Additionally, extensive landscape mitigation plantings are central to the development of the designated area to block both noise and views to the area from surrounding properties. Noise may be defined as unwanted sound. Evaluation of noise requires a consideration of loudness at various pitches. Loudness is measured in units called decibels (dB). Since the human ear does not perceive all pitches or frequencies equally, noise levels are adjusted (or weighted) to correspond to human hearing. This adjustment is known as the A-weighted scale, abbreviated dBA. In general, levels over 70 dBA are considered unpleasant by most individuals; levels under 50 dBA are generally perceived as acceptably quiet. For the average person, levels in life are usually somewhere in between. Any amplification devices will be restricted to State standards for residential uses at all property lines. Hawaii Administrative Rules (HAR), Title 11, Chapter 46, "Community Noise Control" establishes maximum permissible sound levels in dBA according to zoning districts. Residentially zoned land is considered Class A as provided in section 11-46-3. Class A requires the lowest maximum permissible sound levels, 55 dBA. For comparison, Agriculturally zoned land is considered Class C and allows for the highest maximum permissible sound levels, 70 dBA. Noise levels decline with distance in a predictable way. For example, the typical range of voice levels runs from 70 - 88 dBA (normal to shouting) measured within one foot. It is important to note that for every doubling of the distance from the noise source the sound pressure level decreases 6 decibels. Accordingly the 88 dBA voice level will decrease to 54 dBA if measured only 48 feet from the noise source. The event area will be 200 feet from the nearest property boundary line. Therefore it is expected that if measured the anticipated noise levels at the nearest boundary would be below the property line limits established. 18 Puakea Guest Ranch Special Permit Considering this, the proposed use should not generate noise in excess of levels that would be expected from normal agricultural and ranching operations that otherwise would occur on the property. It should be noted that if the proposed Guest Ranch is not implemented, normal agricultural activities that could be conducted on the property could generate substantial noise. DOH noise limits stated in HAR 11-46 notwithstanding, the Right to Farm Act statute of the State of Hawaii (HRS 165-1 to 6) permits bona fide agricultural operations to proceed even when they produce noise. The statute, one of 50 that exists in all 50 states, protects farms using commonly accepted agricultural practices from being considered a nuisance in agriculturally zoned areas. This act is seen by state legislatures as critical for our nation's ability to protect its own food, fuel and fiber production. HRS Chapter 165-4 states that"No court, official, public servant, or public employee shall declare any farming operation a nuisance for any reason if the farming operation has been conducted in a manner consistent with generally accepted agricultural and management practices. There shall be a rebuttable presumption that a farming operation does not constitute a nuisance." Although Puakea Ranch's current agricultural operations produce minimal noise, future uses by this or other owners could very well produce noise considerably in excess of those allowed and regulated in a Guest Ranch. If noise does become a concern, the owners have pledged to work cooperatively with neighbors to find ways to reduce it. CRITERIA: C. IMPACTS ON PUBLIC AGENCIES Fire, police and emergency medical services are available at a full-time fire station and a police station in Kapa'au, located approximately five miles to the east. The Police Department already provides service to this area and no significant increase in demand for public safety services is anticipated. Acute medical care service is available at Kohala Hospital in Kapa'au and at North Hawaii Community Hospital located in Waimea, approximately 23 miles away. No substantial impacts upon these facilities would be expected from the addition of approximately 20 guests per day and periodic events. The Applicant will conform to Fire Department requirements relative to the retention of adequate water storage on the site to meet fire fighting requirements in accordance with NFPA 1142 Standard on Water Supplies for Suburban and Rural Fire Fighting. There is plenty of clearance for a hammerhead turn around space is provided on the subject property for fire vehicles.1 Solid waste from the Guest Ranch will be hauled by Puakea Ranch staff or commercial disposal operators to the County's West Hawaii Sanitary Landfill in Pu`uanahulu, which has several decades of capacity. The Applicant is proposing to hire employess from within the North Kohala community so will not generate additional burden on public educational resources. New water demand will be provided from on-site sources and all wastewater and all runoff from newly harden surfaces will be contained on-site. I 19 i IPuakea Guest Ranch Special Permit IBecause of the nature of the Proposed Action increasing the value of the property and involving more guests and employees, real property, payroll, GET and TAT tax contributions would more than compensate for extra costs of public services and would also enable agencies to improve and expand their services. I CRITERIA: D. UNUSUAL CONDITIONS SINCE THE DISTRICT BOUNDARIES WERE ESTABLISHED I The State Land Use boundaries were established in the early 1970's when Kohala Sugar Company was still in operation. It has now been nearly 40 years since sugar was planted on the bulk of North Kohala's agricultural lands. Since that time North Kohala has seen just 1,200 I of the prior 20,000 acres of active crop land replaced with new crops. Data provided in recent baseline studies indicated that 1,100 of those acres are in macadamia nuts, 89 acres are in Tropical Fruits, 92 acres are in flowers and foliage and just 16 acres are in vegetable crops. I There are about 880 acres in dairy use and the remainder of the acreage is pasture use or lies fallow. The predominant use of most of the agriculturally zoned properties in Hawi and Puakea isIresidentialinnatureandusessurroundingagriculturalpropertiesforlowintensitypastureor small orchard uses. From an agricultural perspective, the proposed use is not significantly different from what surrounds it. The owners have carefully considered the interaction of the I Guest Ranch activities with agriculture and has designed a project that will promote current and future agricultural uses of the property rather than detract from them. ICRITERIA: E. PROPERTY SUITABILITY FOR PERMITTED USES IThe site is suitable for the requested use. As noted earlier, the subject property has a storied history with a signifiant connection to the legacy of agricultural development of Kohala and the islands. Most recently that has included the attraction of overnight guests with an emphasis onIeducatingandinspiringthosethatvisitwiththeagriculturalsignificanceoftheproperty. The applicant proposes to accentuate agricultural activities on the property as an auxiliary use to the proposed guest ranch. This is a big part of what is being proposed. I There are no topographic or other environmental, archaeological, or cultural constraints that would render the site unfeasible for the requested use. All of the basic infrastructure is or can i I be made available to the site by the applicant. Furthermore, the site is situated near Hawi. This will provide another potential employment base for residents of North Kohala, some of whom travel outside of the district for employment. i CRITERIA: IF. ANTICIPATED CHANGE IN CHARACTER OF THE LAND The proposed use will result in little change to the existing property. Existing structures will be I retained and repurposed. In fact this is mandated through the Historical Preservation. The basic agricultural ambiance will still be retained with the balance of the 32+ acre site continuing I20 Puakea Guest Ranch Special Permit to be used agriculturally. To minimize the visual impact and impacts to any residence, the structures will be kept to a residential scale and tucked in at the proosed location. As discussed above, the owners have attempted to address noise concerns through a redesign of Guest Ranch facilities and activities plus restrictions on the scale and timing of various activities. These should combine to reduce noise impacts at the property line to levels permissible in residential districts, which are much stricter than applicable agricultural standards that would apply for land use as a ranch or farm. CRITERIA: G. GENERAL PLAN The General Plan for the County of Hawai'i is a policy document expressing the broad goals and policies for the long-range development of the Island of Hawaii. The plan was adopted by ordinance in 1989 and revised in 2005 (County of Hawaii Planning Department). The General Plan itself is organized into thirteen elements, with policies, objectives, standards, and principles for each. There are also discussions of the specific applicability of each element to the nine judicial districts comprising the County of Hawaii. Analysis for this propsed use confirms that it generally satisfies the following Goal and Policies, and Courses of Action of particular chapters of the General Plan: ECONOMIC GOALS The Proposed Action is in balance with the natural, cultural and social environment of the County, and it will create temporary construction jobs and permanent Guest Ranch jobs for local residents and indirectly affect the economy through purchases of materials and supplies for the Guest Ranch and secondarily through employee purchases. A multiplier effect takes place when 111theseemployeesspendtheirincomeforfood, housing, and other living expenses in the retail sector of the economy. Such activities are in keeping with the overall economic development of the island. ENVIRONMENTAL QUALITY GOALS, POLICIES AND STANDARDS The Proposed Action would not have a substantial adverse effect on the environment and would not diminish the valuable natural resources of the region. The Proposed Action will obtain permits and follow the conditions designed to reduce or eliminate pollution and environmental degradation. The Guest Ranch would assist in maintaining agricultural uses on the property by subsidizing them and providing a built-in market for garden and farm produce. HISTORIC SITES GOALS AND POLICIES Archaeological resources in the area to be affected by construction have been properly assessed through an inventory survey prepared by Haun and Associates conducted in October, 2018. The survey is included in Appendix 2. The current owners of Puakea Ranch placed the entire property on the State Historic Register as one step in preserving the integrity and significance of the architectural features of the ranch. All new construction will undergo review by SHPD to ensure consistency with the appropriate Secretary of the Interior's Standards for Treatment of Historic Properties. FLOOD CONTROL AND DRAINAGE GOALS, POLICIES AND STANDARDS The property lies entirely within Zone X, outside the 500-year flood zone, and involves minimal ground disturbance. All standards regarding drainage, flooding and sedimentation will be 21 Puakea Guest Ranch Special Permit adhered to and project design will be reviewed by and subject to permits from the County of Hawai'i Department of Public Works and the Hawaii State Department of Health. NATURAL BEAUTY GOALS AND POLICIES The Proposed Action would have no adverse effect of scenic sites or view planes. NATURAL RESOURCES AND SHORELINES GOALS AND POLICIES The Proposed Action, which would occur more than a mile from the coast, has no effect on natural resources or shorelines. Impacts to existing natural landforms will not occur due to the minor nature of the Proposed Action's ground disturbance. Landscaping will match the existing historic character of the property. LAND USE AND OPEN SPACE GOALS AND POLICIES The Proposed Action takes place on a historic property already occupied by ranch buildings and will have not effect open space. LAND USE, AGRICULTURE, GOALS AND POLICIES The Proposed Action would occur on agriculturally zoned land in an area designated by the LUPAG as Important Agricultural Land. The owners have carefully considered the interaction of the Guest Ranch activities with agriculture and has designed a project that will promote current and future agricultural uses of the property rather than detract from them. Currently, Puakea Ranch guests eat from a large garden and orchards growing lavender, pineapple, lilikoi and dragon fruit as well as other boutique crops. The Proposed Action will not have an adverse effect on the agricultural utility of the property and its function as a green belt. Based upon the foregoing, it is concluded that the project is an "unusual and reasonable" use of the subject site and would promote the effectiveness and objectives of Chapter 205, Hawaii Revised Statutes. 22 Puakea Guest Ranch Special Permit I this page intentionally left blank] i I 1 1 1 111I I 1 ' 1 I I I I SPECIAL PERMIT PUAKEA GUEST RANCH I I TMK: (3rd) 5-6-001:082 I Puakea, North Kohala District, Hawaii Island, State of Hawai`i I I Appendix 1 Referenced Correspondence I 1 I I I I I I 1 I I w"T'Ps DEPARTMENT OF WATER SUPPLY • COUNTY OF HAWAII3e Euw; i,P,' 345 KEKUANAO`A STREET, SUITE 20 • HILO, HAWAII 96720 TELEPHONE (808) 961-8050 • FAX (808) 961-8657 December 11, 2018 Ms. Christie Cash Puakea Ranch 56-2864 Akoni Pule Highway HAwi,HI 96719 Dear Ms. Cash: ISubject: Pre-Environmental Assessment Consultation Puakea Guest Ranch Special Permit Tax Map Key 5-6-001:082 This is in response to your Pre-Environmental Assessment Consultation request dated November 26,2018. Please be informed that the subject parcel is served by an existing master meter which also provides service to eight(8)other parcels. The master meter is allowed an average usage of 3,600 gallons per day or 400 gallons per day for each parcel(adequate for only one(1) single-family dwelling/parcel). I The Department will note that the average daily water consumption through the existing master meter,over the past two(2)year period,is approximately 5,550 gallons per day. The proposed use will increase water demand. However,the Department cannot provide any additional water at this time for any other type of development requiring additional water within the Puakea Ranch Subdivision. Extensive improvements and additions,which may include,but not limited to source, storage, booster pumps, transmission, and distribution facilities,would be required. Should there be any questions, please contact Mr. Ryan Quitoriano of our Water Resources and Planning Branchat961-8070, extension 256. Sincerely yours, Keith K. Okamoto, P.E. Manager-Chief Engineer I RQ:dfg copy—Geometrician Associates 1 Water, Our Most Precious qZpource. . . WaiA ane. . . The Department of Water Supply is an Equal Opportunity provider and employer. 1 I DAVID Y.IGE i o•„JADE T.BUTAY GOVERNOR tl .4,DIRECTOR l C. 1 I.Deputy Directors* . ROSSM.HIGASHI I 4 . ' EDWIN H.SNIFFEN r Y' DARRELL T.YOUNG STATE OF HAWAII IN REPLY REFERTO: DEPARTMENT OF TRANSPORTATION HWY 2576 869 PUNCHBOWL STREET HWY-PS 2.9159 HONOLULU,HAWAII 96813-5097 January 7, 2019 Ms. Christie CashIPuakeaRanch 56-2864 Akoni Pule Hwy Hawi, Hawaii 96719 IDear Ms.Cash: I Subject:Pre-Consultation for Environmental Assessment Puakea Guest Ranch Special Permit Hawaii, North Kohala, Hawi,TMK: (3) 5-6-001: 082 I Thank you for your letter of November 26, 2018 requesting input from the Hawaii Department of Transportation (HDOT) for the preparation of an Environmental Assessment (EA). The Iassessment is required for compliance with Hawaii Revised Statutes, Chapter 343 due to Puakea Ranch being on the Hawaii State Historic Register and your proposed guest ranch would be a use within the historic site. I fTheHDOTrequeststhataTrafficAssessmentbepreparedbyalicensedprofessionalengineerI and submitted for review and acceptance. The assessment should include estimated trip I generation, an evaluation of the project access to Akoni Pule Highway, State Route 270, and recommend improvements as needed. These improvements shall be provided at no cost to the State. i IHDOT wishes to be a consulted party to the Draft EA. A copy of the assessment,when published should be submitted to the Highways Planning Branch and the Hawaii District Engineer. I If there are any questions, please contact Ken Tatsuguchi, Engineering Program Manager, Highways Planning Branch, at (808) 587-1830. Please reference file review number 2011-247. ISincerely, I 6171 1'''-31 - 1 JADE T. BUTAY Director of Transportation Puakea Guest Ranch Special Permit I I this page intentionally left blank]I 1 I I I I 3 I I 1 I I I 1 I i 1 1 SPECIAL PERMIT PUAKEA GUEST RANCH 1 1 TMK: (3rd) 5-6-001:082 Puakea, North Kohala District, Hawaii Island, State of Hawai`i I Appendix 2 Archaeological Inventory Survey I 1 1 i Report 1510-022019 DRAFT I ARCHAEOLOGICAL INVENTORY SURVEY TMK: (3) 5-6-001:POR. 082 1 1 t Y 4 1 PUAKEA AHUPUA`A NORTH KOHALA DISTRICT, ISLAND OF HAWAI'I HAUN & ASSOCIATES ARCHAEOLOGICAL, CULTURAL,AND HISTORICAL RESOURCE MANAGEMENT SERVICES 73-4161 KAAo ROAD, KAILUA-KONA HI 96740 PHONE: 808-325-2402 FAX: 808-325-1 520 i Report 1510-022019 DRAFT ARCHAEOLOGICAL INVENTORY SURVEY TMK: (3) 5-6-001:POR. 082 PUAKEA AHUPUA'A r NORTH KOHALA DISTRICT ISLAND OF HAWAI'I Prepared by: Alan E. Haun, Ph.D. and Dave Henry, B.S. r Prepared for: Puakea Ranch 56-2864 Akoni Pule Highway Hawi, Hawai'i 96719 1 February 2019 HAUN & ASSOCIATES ARCHAEOLOGICAL, CULTURAL,AND HISTORICAL RESOURCE MANAGEMENT SERVICES 73-4161 KAAO ROAD, KAILUA-KONA HI 96740 PHONE: 808-325-2402 FAX: 808-325-1 520 i r TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 MANAGEMENT SUMMARY Haun &Associates conducted an archaeological inventory survey of a 2.14 acre portion of TMK: (3) 5-6-001:082; a 32.411 acre parcel in Puakea Ahupua'a, North Kohala District, Island of Hawai'i. The archaeological inventory survey objective is to satisfy current historic preservation regulatory review inventory requirements of the Department of Land and Natural Resources-State Historic Preservation Division (DLNR-SHPD), as contained within Hawai'i Administrative Rules, Title 13, DLNR, Subtitle 13, Chapters 276 and 284, State Historic Preservation Rules. g This AIS is prepared in conjunction with a Special Use Permit to be prepared for the County of Hawai'i Planning and Building Department.The landowners propose to operate the Puakea Ranch as a "Guest Ranch"with the 2.14 acre project area to be used for weddings and other functions and events.. The archaeological inventory survey identified three features (Features 7, 10.1 and 13) of a previously identified site. The Puakea Ranch headquarters was recorded by the landowners in a June 2009 National Register of Historic Places form (NRHP) and the ranch buildings were subsequently assigned State Inventory of Historic Places (SIHP) site number 50-10-02-90711.The features consist of a modern building built over an historic concrete slab(Feature 7), a section of the Feature 10 wall designated as Feature 10.1, and a newly identified concrete slab that appears to be historic in origin (Feature 13). A chicken coop and a farm stand have been built on the Feature 13 concrete slab. The portion of Site 9071 in the project area is unaltered and in fair condition. The previously prepared NRHP form indicates Site 9071 is assessed as significant under criterion "a" because of its association with events that made a contribution to the broad patterns of history (sugar cane cultivation and cattle ranching), under criterion "b" due to its association with Dr. James Wight, under criterion "c" as an excellent site type example, and under criterion d"for its information content. Site 9071 was determined eligible for inclusion in the National Register of Historic Places. The proposed development will have an effect on the historic properties within the project area. The landowner proposes minimal impacts to the 2.14 acre project area, consisting of constructing an approximately 2500 sq foot space that contains an Americans with Disabilities Act (ADA) approved restroom, kitchen facility and a space for set up in an enclosed area.The majority of the area will not be impacted by the proposed development and will function as an open event area for weddings and other functions; however,the Feature 7 and 13 slabs will be destroyed to make 111wayfortheADAimprovements.The Feature 10.1 wall will be preserved. The Feature 7 and 13 slabs are not integral components of the Puakea Ranch and functioned as minor elements of the facility. In order to mitigate their destruction, the proposed restroom will be designed in accordance with the Secretary of the Interior Standards for rehabilitation which is defined as"...the process of returning a property to a state of utility, through repair or alteration, which makes possible an efficient contemporary use while preserving those portions and features of the property which are significant to its historic, architecture, and cultural value." NPS.gov.) The restroom will be aesthetically compatible with the other historic structures on the property, constructed with board and batten siding and corrugated metal roofing. The restroom will be constructed in such a manner that if removed in the future, the essential form and integrity of the remaining historic properties and its environment would be unimpaired. Cover photo: Overview of project area(view to south) 1 All sites listed on the State Inventory of Historic Places(SIHP).Site numbers are 5 digit sequential numbers by island 50=State of Hawai'i,10=Island of Hawai'i, 02=Hawi quadrangle,9071=Site number HAUN &ASSOCIATES I ii 1 I TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510-022019 1 I Contents MANAGEMENT SUMMARY ii IINTRODUCTION 1 Scope of Work 1 Project Area Description 1 IARCHAEOLOGICAL AND HISTORICAL BACKGROUND 9 Historical Documentary Research 9 IPrevious Archaeological Research 24 PROJECT EXPECTATIONS 29 I CONSULTATION 29 FINDINGS 31 CONCLUSION 37 IDiscussion 37 Significance Assessments 37 ITRANSLATION OF HAWAIIAN WORDS 38 REFERENCES 39 I APPENDIX A: LAND COMMISSION AWARDS IN PUAKEA AHUPUA'A (FROM WAIHONA AI NA) 43 APPENDIX B: NRHP NOMINATION FORM 49 I Figures IFigure 1. Portion of 1995 USGS 7.5' Hawi Quadrangle showing project area 2 Figure 2.Tax Map Key(3)5-6-001 showing project area 3 I Figure 3. May 15,2018 aerial view of project area vicinity from Google Earth 4 Figure 4.Grass lawn(view to south) 4 Figure 5.Grass lawn and dirt road (view to southeast) 5 I Figure 6.Guinea grass(view to north-northwest) 5 Figure 7. Dirt road and guinea grass(view to west) 6 Figure 8. In-ground swimming pool(view to northeast) 7 Figure 9. Boulder pushpile(view to west 7 1 I Figure 10.Ahupua'a boundaries 10 Figure 11. Map of the North Kohala District from Tomonari-Tuggle(1988:4) 11 Figure 12, Map of the North Kohala District at Contact from Tomonari-Tuggle(1988:17) 12 Figure 13.Tomonari-Tuggle's(1998)map of the Kohala Field System showing project areaI14 Figure 14. Portion of Lydgate's 1893 Hawai'i Register Map 1705 17 Figure 15.Map of the North Kohala District in the Later 19th Century from Tomonari-Tuggle(1988:41) 19 I Figure 16. February 13, 1920 article from The Pacific Commercial Advertiser(from newspapers.com) 21 Figure 17. February 9, 1932 article from The Honolulu Advertiser(from newspapers.com) 23 Figure 18. Portion of 1930 USGS Hawi Quadrangle showing project area 25 Figure 19. 1976 USGS aerial photograph of project area vicinity 26 HAUN &ASSOCIATES I iii 3 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Figures (cont.) Figure 20.Current extent of Puakea Ranch 27 Figure 21. Previous archaeological work 28 Figure 22. Location of Site 9071 features from NRHP form 32 Figure 23. Feature location map 33 Figure 24. Modern shed built over historic Feature 7 concrete slab(view to southeast) 34 Figure 25.Modern shed built over historic Feature 7 concrete slab showing Feature 10.1 wall (view to north) 34 Figure 26. Feature 10.1 wall (view to southeast) 35 Figure 27. Plan map of Feature 13 35 Figure 28. Feature 13 concrete slab and modern chicken coop and farm stand (view to south) 36 Figure 29. Feature 13 concrete slab and modern chicken coop and farm stand(view to west)36 Tables Table 1. Land Grants in Puakea Ahupua'a 16 Table 2. Previous archaeological work in Puakea Ahupua'a and surrounding areas 27 Table 3.Site 9071 features from NRHP form 32 I I HAUN &ASSOCIATES I iv TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 INTRODUCTION At the request of the Puakea Ranch, Haun & Associates completed an archaeological inventory survey (AIS) of a 2.14 acre portion of TMK: (3) 5-6-001:082;a 32.411 acre parcel in Puakea Ahupua'a, North Kohala District, Island of Hawai'i (Figure 1 and Figure 2). The objective of the survey was to satisfy historic preservation regulatory review requirements of the Department of Land and Natural Resources-State Historic Preservation Division (DLNR-SHPD), as contained within Hawaii Administrative Rules, Title 13, DLNR, Subtitle 13, State Historic Preservation Rules 2003). This AIS is prepared in conjunction with a Special Use Permit application for the County of Hawai'i Planning and Building Departments. The landowners propose to operate the Puakea Ranch as a "Guest Ranch" with the 2.14 acre project area to be used for weddings and other functions and events. The survey fieldwork was conducted on October 4, 2018 by Haun & Associates Project Supervisor Solomon Kailihiwa, M.S and Field Archaeologist, Dan Trout, B.A., under the direction of Dr. Alan Haun. Approximately two person days of labor were required to complete the fieldwork portion of the project. Described in this final report are the project scope of work, field methods, background information, survey findings, and significance assessments of the sites with recommended treatments. Scope of Work Based on DLNR-SHPD rules for inventory surveys the following specific tasks were determined to constitute an appropriate scope of work for the project: 1. Conduct background review and research of existing archaeological and historical documentary literature relating to the project area and its immediate vicinity--including examination of Land Commission Awards, ahupua'a records, historic maps, archival materials,archaeological reports,and other historical sources; 2. Conduct a high intensity, 100%pedestrian survey coverage of the project area; 3. Conduct detailed recording of all potentially significant sites including scale plan drawings, written descriptions, and photographs,as appropriate; 4. Conduct limited subsurface testing (manual excavation) at selected sites to determine feature function; 5. Analyze background research and field data; and 6. Prepare and submit Final Report. Project Area Description The project area is a rectangular-shaped 2.14 acre area located within Puakea Ranch at elevations ranging from approximately 530 to 605 feet. The elevations presented in this report are in feet above mean sea level (AMSL). Figure 3 is an aerial view of the project area taken on May 15, 2018. A plan map of the project area is presented as Figure 23 in the Findings section of this report. The project area is bordered on the north,west and south sides by a dirt road with a stone wall (Site 9071, Feature 10.1) forming the eastern project boundary. The majority of the project area is comprised of a maintained grass lawn (Figure 4 and Figure 5) and areas of dense guinea grass(Panicum maximum;Figure 6 and Figure 7). Stands of koa haole (Leucaena glauca), with kiawe (Prosopis pallida) are also present. Additional vegetation in the project 1 area consists of night-blooming cereus (Hylocereus undatus), hibiscus (Hibiscus tiliaceus), macadamia nut Macadamia integrifolia), royal poinciana (Delonix regia), java plum (Syzygium cumini), monkey pod (Samanea saman),dragonfruit(Hylocereus undatus),and various ornamental plants. HAUN & ASSOCIATES I 1 I sit TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 NM% I UP HONOKAA WAIMEA 40 warmpirnwqp6 1pirer"'"""..... illiera" i, 1 KEALAKEKUA P OA i PAHALA Tanks 4 AALEHU f„,‘,, ,,,,z,,, o Eo A --" . 4 q 9 AM N sr-?,----. t t`C," r• '`,....7 \„,...- litlia".„. 01110,,,_ 1 2 r' r ter'r t Opt t 410,,, i \ . _....., ...... Arrom...... A_111 4117, \ , /- 4"""*, 1,4#a ii. I oser t %,r. (3) / ,..iii, 4:. 7",_.,„—---— el i' s' . Silk: t 11 11, r V v F i ii " k u IHOLAHISTORICALSTES1 PC r STATE MONO ENT'—. 0 r I Figure 1.Portion of 1995 USGS 7.5'Hawi Quadrangle showing project area I HAUN &ASSOCIATES 12 I I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 I I OM1 V iR a xrs:tit 2 l 6....- w i 3 i I t µ 1 t\Y F i<<t °p ly Y 1 iI_ t0T ';' e \ ;• i 6*---rit"\ yer 10 0 Z ( J i \ o.:„< e\, a\ ,I \\4 s 1 s., C • -11off 03 t* T\jr t/ ,_ il . 1 N 11 et v -4, AkA.e ' o•.. 7. \0 4 4 o.,,,,, / •.. ,'.. \ ,- k \\ 1111 - ____lt\ç \ - I tAlpir:Lit°• a , 11 I\ v 11,\.. 1:d r Co• AQ- \i ., ''i • '`` t` " ' t \ 'i 1`1 •LL e3 sfi{, a1‘ C:::- 0 i 1 .I I ,. t'L iCO j 1 I ti ar1TS o F f0 F tt/ij if„i A t (. J j 1 " 4 {:, 1 ',: li! j O J p I yle t e 4 I•_ t ti L i'+ 1I NI:1 fa al 1li'C-:'7-I 1 r/ 03 O. IJ a 0 i? idd 2 I' l G)0, 00 STm-a...Gr-.FJ_---- LL I HAUN &ASSOCIATES 111 I w TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 t t Puakea Ranch TMK:(3)5-6-001:082 4'''''''''",- s, I Project area I II I Figure 3.May 15,2018 aerial view of project area vicinity from Google Earth I 1k I a I I I Figure 4.Grass lawn(view to south) HAUN & ASSOCIATES 14 TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510 022019 4,04 z 1 r Figure 5.Grass lawn and dirt road(view to southeast) L It Y g m lA- 1111 mac- ,_.e44 a..S*t4'4I.«..z.._............. _..,d.' .6d e=...._. .._.....:._...i.,.,cc..._.-`...._.s2"st''2.Pai.V:.i. Figure 6.Guinea grass(view to north-northwest)01 HAUN &ASSOCIATES J 5 I TMK : ( 3 ) 5 6 001 : Por . 082 Report No . 1510 022019 111 1 oiririelpiii.,, ,04-**,,,,,,,, " 1 r Jiff' f" ..#14',. i . ' - mak 0, B r - r '•,'.,. s'.' '1.,;,:,'f ray ,` I r'. ir Figure 7.Dirt road and guinea grass(view to west)I There is an in ground swimming pool located in the western portion of the parcel (Figure 8) and a concentration of boulders located in a stand of trees to the west of the pool (Figure 9).The boulders were likely bulldozed into their current location during the ranching activity in the area.A modern shed built on an historic concrete slab is located along the eastern boundary of the project area (Site 9071, Feature 7) and an historic concrete slab with a modern chicken coop and an egg stand is located in the northern end of the parcel (Site 9071, Feature 13). These features are discussed in detail in the Findings section of this report. The soil in the project area is Kohala silty clay (KhC) on 3_12%slopes.This soil is characterized by an approximately 14 inch thick surface layer of dark silty clay, over an approximately 25-inch thick subsoil of silty clay loam and silty clay (Sato et al. 1973:31). This is underlain by a substratum of weathered igneous rock. It is classified as suitable primarily for sugarcane with small areas used for pasture, orchards and truck farms. The underlying weathered igneous rock substratum was deposited during lava flows associated with the Ha Volcanic Series (Wolfe and Morris 2001:14 and Sheet 1) and according to Macdonald and Abbott (1970) these flows were deposited approximately 60,000 to 250,000 years ago. Annual rainfall in the vicinity of the project area ranges from 204 to 750 mm (8 to 30 inches; Giambelluca et al. 2013). The mean average temperature in this general area is approximately 73.8 degrees F (usclimatedata.com). . There are no surface water sources in the project area. Methods Archival research was conducted at the Hamilton Library Haw and Pacific Collection at the University of Hawaii at Manoa,the University of Hawaii at Hilo Hawaiian Collection,the Land Survey Office and the Archives Division of the Hwai'i Department of Accounting and General Services, the Bishop Museum Archives, the State Historic Preservation Division library in Hilo, the State Survey Division, and the Hawaii State Public Libraries in Honolulu and Hilo. HAUN &ASSOCIATES 6 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Oif„*, r 1 1 Figure 8.In-ground swimming pool(view to northeast) i t / f 1 Figure 9.Boulder pushpile(view to west HAUN &ASSOCIATES 17 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 The field work portion of the project consisted of a 100% surface examination of the parcel with the surveyors walking transects at 5-meter intervals. Ground surface visibility throughout the parcel was fair to excellent. The features identified during the project were flagged with pink and blue flagging tape and their locations were determined with the aid of a Garmin Global Positioning System (GPS) Model 60-series device using the North American Datum (NAD) 1983 datum. The accuracy of the GPS device for a single point is +/- 3-5 m. This accuracy was increased to approximately 2-3 meters by taking multiple points including property corners and overlying the plotted points on a scaled map using AutoCAD software. The three features of Site 9071 in the project area were documented by completing a standardized site form, and photographic documentation. The Feature 13 slab with modern chicken coop and farm stand were also recorded by preparing a scaled plan map made with hand tapes and compass. Due to the historic age of the features, no subsurface testing was conducted and no cultural material was recovered for analysis. 1 1 1 1 3 HAUN & ASSOCIATES 18 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 ARCHAEOLOGICAL AND HISTORICAL BACKGROUND Historical Documentary Research The project area is situated in the ahupua'a of Puakea in the northern portion of Hawaii Island (Figure 10). The project area is located within the boundaries of the historic Puakea Ranch headquarters area and is situated approximately 100 meters inland of the Akoni Pule Highway (Highway 270). The project area is locatedIII approximately 800 meters seaward of Puu Ula (see Figure 1) and is situated approximately 2,400 meters (1.5 miles) inland from the shoreline at Puakea Point. According to Ulukau, the Hawaiian Electronic Dictionary (2018), Puakea is literally translated as "Pale or wanting color". The ahupua'a originates at the shoreline between Puakea Point and Hianaula Point and extends inland 4,100 meters(2.5 miles)to approximately 1,240 ft elevation. It is bordered on the north by Honoipu Ahupua'a and on the south by Kukuipahui Ahupua'a. Tomonari-Tuggle (1988) presents a comprehensive historical overview of the North Kohala district, separating the area into two distinct geographic zones; the windward and leeward areas which are divided by the ridges of the Kohala Mountain range in a northwest by southeast direction (Figure 11). This line extends between Pu'u Kahone tin the northwest to Pu'u Pili in the southeast and serves as the demarcation between the dry leeward side and the relatively wet windward side. The project area is located in the leeward area. According to Tomonari-Tuggle 1988:5): The long ridge of Kohala Mountain lies perpendicular to the predominant moisture-laden northeast trade winds and acts as a deflector, pushing the trades upward, where the resultant cooling condenses the moisture,forming clouds and rain over the summit. The rainfall decreases on the leeward side as the air warms in its return to lower elevations. High rainfall is centered over the head of the windward valleys, where average measurement is 200 inches. At the mouth of the Honokane Nui Valley, it is 60 to 80 inches, decreasing northward toward Hawi where it is 50 inches per year. On the leeward side, median annual rainfall is approximately 60 inches at Pu'u Hue, which is 579 m (1900 ft) above sea level (Taliaferro 1959:136-137) and approximately 13 inches at Mahukona at the coast. (Tomonari-Tuggle 1988:132-133). Tomonari-Tuggle cites several historical accounts that document the extensive agricultural use of Kohala.The extent of the agricultural fields at contact is presented in Figure 12. According to this figure,the project area is located in the area of non-irrigated agriculture.The During Lt. King's 1779 exploration of the Kohala region,he states: The country, as far as the eye could reach, seemed fruitful and well inhabited...[three and four miles inland, plantations of taro and potatoes and wauke] neatly set out in rows. The walls that separate them are made of the loose burnt stone, which are got in clearing the ground; and being entirely concealed by sugarcanes planted close on each side, make the most beautiful fences that can be conceived. [The exploring party stopped six or seven miles from the sea] at the second but they found among the plantations...To the left a continuous range of villages, interspersed with groves of coconut trees spreading along the sea-shore; a thick wood behind this; and to the right, an extent of ground laid out in regular and well-cultivated plantations, as far as the eye could reach(cited in Tomanari-Tuggle 1988:16-18). I HAUN & ASSOCIATES 19 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 -022019 I Upolu AIrpiM x\ f 9 \ limukokoPoint I j V A'i., 7 I UmiwaiBay \'\\ 0 a \ I \\ \\ ."Ir 7 A\ Upolu Airport Road A- P l r i l v vN v\ 9 N 1,,, \ 'So ,....\,--.5\" \ ti N. v ` I/v `` v v v ASG N. N. A 1 A } Honoipu landing N.` C ok'0 ''..`v \\ \t. N N. Puakea Point—t Ao N / N Hotana Bay N , N'` A H In 2/0) Hwy \ wy 5,f'a/t q GFA I ANN J ,.- \\\ deo N I N v\%, 1 e°° l' a417-- - F \ S Projectarea \ N''. \\ S3 o 7MK:(3)6.8-041082 N N. s N 111N. Kohala Ditch s 1000s Akonl Pule Hwy 1 Hwy 270) r 1 j___600 j(/ t AWAIUA Contour Interval=200 ft 400 3000ft Ahupua'a Boundary i Ditch m Figure 10.Ahupua'a boundaries ill HAUN & ASSOCIATES 110 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 I uPetw P+ iGONAL.A >•t FlyuR,I: I. THE DISTRICT OF NOUN KOALA 6s-«..6.- I 15-AND OF I4AWAI'I o z 3 Mi O I 1 E 4 Kars t I U 1u Pt Ks Lars P° W!NOWA12P KULA bLOPE. c.wtNOwActD r KHLA yuLCU Nonot N FUuhoL. PPNisi1 ( I / Kan.nc i ` r j '' / A••• Nape. 8aTIllL.;F" NAWI IN. ICAPA'/W KiPanaia bay Ktok.ca Bar Project l fv N1UW:1 Ni ,Bat area i'fje ' I Iii j / 1 wnanwatm vtiiFY`j o Poialu Ir i:, Nonokinc Nu. tMihukona 41,l e. 1 KA21'I. Pu'u Nuc 1 f 1!ef..FT) 9EPtetttcherraf't; g L11111uOli Q 3383 F* Z 4: klii \ c 1 v.*Rita P.1,te—ilgawnuiba' r r 1, r"' 1LirP P/ / pv Waaka',ho Har ypJis Obi N Kat opac F iFigure11.Map of the North Kohala District from Tomonari-Tuggle(1988:4) 1 L HAUN & ASSOCIATES 111 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 I I NO'0v-iN1 14 e1A4 0 0,- 4.. ",.....''...., 0 •• ...;•••fr:-..."'....1 '.4 a,....--!-.4 ,....-, ..--4) to 0 KALIROLA,PT. Ita, t_- 4"...."--,'t t.3 ---i-' i 1 v ir 22 '°-- 7. tZve3(^ 4, /hewli.....:::------ r 3•-'" - _-----:---,-..•• . NAN'k bATiok:.•-•''-7-:- -__.-A.:,. 6.7-, KAPA WO A DA', KEOKEA 13,71'I ar„, ......... r ,sr J.-.,it v -'7., A, f._projim. 17,f ii I, r, ..„---,?;:.„-S-.;:.> . _ gw, ----.5 AI....ii".:-.:-..- - :- --- 0 KUKU P4114 ......--' c r-:::----- Ar444-4A•-•"..--;. 14CIA14 .4.•LA 0:„....._->.:---_...,,- -- ;--- .:.:'"-.:::•-**- :-..-4Y;3.--.1.7. IA.. -"FiffilAnik.0.:..."..... EMMA0--/,....-....""'../......'''' ... .. . .;•\'•--:" „.*....-S 3.1;f- POLOLii CAFA'A-:7,-....._2-- s"--4-...":".-a-4''. 4;;e41/.... .6 HONIOKi NE 2.<--;:.•-••• e..- ....- Numw,.....>--.:...,:„...-.1. 1.14,41114.1141,4 0 • 7:4 NYl'.1.4 IV.I AZ:: ...: 57411, 1 . t. ......- 4..... • .. ,''...MOA 7:',..: 12486,:::.;;;.. Ai:::>,.....?..,_..4 ...../.7.„9 1 - -...'-46r1110,A.---..--- 3 i-r-t IIIKOAI'r. F.A wwW+44 .--,......,:- r e".. 0- _.-Parr woo g- --- 021 7:::LI 0/•••.„........../L.? L....„...............„.„<......... .................„..„...„..;.:' '.."-''''........„..-....- -•:;...wen, 0:0 iLAMALS11.0A 0° 3-"x - 0' I . I osolP'. t? ,-<:,......„:::;_ . _-.---',"'". '_,,,„• KV+eni•Ar 4.0,.1', Luovoli rt.•4.7 i I7,:::.............„ 1A 04.)' Ot.,),v' -<...---.............../...........;-------K.7.,4‘4I oe. S..LEAYVA14441 84' 4,e. f , pa'.P 5 i, ..........--\...._„....„_....... s.j..... t. vs 4* v 0.--- ,l" 4Q° ir „ nsil* I/". walAKAlue, imi r FILIR.E., 3. NOR.TH KOI-IAL,A AT CONTAGT: KAI'OPAX.. T14E. LATE. 1st GENTURy KNOWN Aer..A5 OF SETTLVAE-NTINoINFERREDAREASOFSETTLEMENT AS OF NON•iER.ICIATEO Mori(IA LTI,IR.E. w..: AU AS Of IRRIGATED 7.421Ci71.-ThRC I o 7.3 MI A wci.444 7--- ..•••••••.-... , O . Z 5 9 LOA KAimM A14.1010:A ft WOES. C.ONE.I414FACANoesFROMeioK.014kLa l41.41,7N COURCIII Mc !)001€-, LOCATiON 'TAKEN FROM r9 15 14545 TO906 RAN 4 mu,- I I Figure 12,Map of the North Kohala District at Contact from Tomonari-Tuggle(1988:17) HAUN &ASSOCIATES I 12 TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510 - 022019 1 Similar observations were made in 1793 by Archibald Menzies and in 1823 by William Ellis. According to Ellis, Streams of water were frequent, and a large quantity of ground was cultivated on their banks, and in the vicinity 1963:19)",and Menzies states: From the north-west point of the island ['Upolu Point], the country stretches back for a considerable distance with a very gradual ascent,and is destitute of trees or bushes of any kind. But it bears every appearance of industrious cultivation by the number of small fields into which it is laid out(cited in Tominari-Tuggle1988:20). As indicated above, the project area is located in Tomonari-Tuggle's (1998) Leeward area. The agricultural use of this area is characterized by a," ...massive field system [the Kohala field system] which sweeps across the leeward slopes of Kohala [and] reaches the coast at the ahupua`a of Kukuipahu" (1988:11-23). This field system extended from the shoreline inland to the forests, and was characterized by cross slope walls designed to block the prevailing trade winds. Using aerial photographs, Tomonari-Tuggle created a map depicting the extent of the 1 Kohala Field System (Figure 13). As indicated in this figure, the present project area is located along the northern fringes of the complex. The North Kohala District is of particular significance as the birthplace of Kamehameha I, who was born just to the south at Mo'okini Heiau (see Figure 12). The district was also the place where his armies gathered to prepare for war and was a training ground for young warriors(I'i 1983:15).According to the National Park Service website, the Mo`okini Heiau is one of the first luakini or sacrificial heiau in the Hawaiian Islands. It is described as follows: Tradition says that a temple was first built on the northernmost tip of the Island of Hawaii sometime in the 5th century by the high priest Mo'okini. Later oral tradition says that the current U heiau was built on the older temple between the 13th and 14th centuries by Pa'ao, a legendary priest from either Tahiti or Samoa who is said to have introduced the Hawaiians to human sacrifice, the walled heiau, and several types of kapu — the system of religious, political, and social laws that governed every aspect of daily life. Pa'ao was said to have lived near Mo'okini Heiau and founded a lineage of priests that served the ali'i 'ai mo (paramount chief)of the Island of Hawai'i through the early part of the 19th century. Ancient Hawaiians had many types of heiau, each with their own distinct function and use by particular segments of society. Heiau ranged in size from single upright stones to massive and complex structures. Larger heiau were built by ali'i (chiefs), but the largest and most complex, the luakini heiau(sacrificial temple),could only be constructed and dedicated by an ali'i'ai moku. Luakini heiau were reserved for rituals involving human or animal sacrifice and were generally dedicated to the war god Ku. Rituals performed at a luakini heiau highlighted the ali'i 'ai moku's spiritual, economic, political, and social control over his lands and his authority over the life and death of his people. Mo'okini Heiau was active through the early part of the 19th century and was Kamehameha l's war temple, housing his family's war god Ku-ka-'ili-moku before the transfer of the god to Kamehameha's new war temple Pu'ukohola Heiau, 21 miles down the coast near Kawaihae. Kamehameha l's son and heir Liholiho also used Mo'okini Heiau. In 1819, after his father's death, Liholiho ended kapu and abolished that part of the Hawaiian religion that depended on heiau. In spite of royal orders that they be destroyed, Mo'okini and several other large heiau were spared. It was believed that they had acquired mana (spiritual energy), which protected them against human destruction. (https://www.nps.gov) HAUN &ASSOCIATES J 13 11 Report No . 1510 - 0220 1 9001 : Por . 08 2TIVIK : ( 3 ) 5 - 6 - i n t a r j - t 7 'Ialliquitrni1 'fg1AV," 1 4011u3 al#1111PigifilifitillirMaIHVtl' iang21: 1111111% I iffinginfinill ii.,smosittrm filltiliklifillim..1 ni a.„,........m.„,... 1 I lit Allow 1 iittuji mai_ 1 ,,„„ilimi i4II ''-'17 7-__-_,Iougmrillmulliia ----------talks rVSiitifillibirommonants .. „ i. A 1.I I, 1, litt NV I Iatilliffitiii111t6lit= , ,GRA611121. 111111\\11 I ,I1011vrtt ...... i 118 i 4 Ir0 14447, II14,47 - , 2il to t44,/ NJ, -.444 ' I UIIflyIF i, 2got— A. i b. imil L-ni' I jigilldill Si It_A 7'ilet 1111!! E1 .1 v, U) s 1 NI II It11111Ililt, Iii1t_ , 74"- r"""4 to To 1 1 ui . I'kr) ,. - J4 p A II a t..7. 44 0. in .1v, c i,41111111 fills 14- r0 2= e. E1riQ• ji COalcr,11111H1III tar ' // f I s 7., t,iiii i a If a I 1.,..., S.itis "pt nt ' „ 4.- b.b.z.„„..... 1- s s .25 . di 4444 fits , C E I ft 0 j.0 0* I-0 eelI016 1.7 U,1 c.7 g1 — sl , 4 , U. HAU N & ASSOCIATES I 14 1 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 In January 1778 Cook landed in Waimea, Kauai and the culture of old Hawaii began its spiraling change(Day 1992). Cook left Hawaii for several months, but returned later in the year. Kalani'opu'u was fighting Kahekili's forces in Wailua, Maui on November 19, 1778 when Cook's ship was sighted on his return trip to the islands. Kalani'opu'u visited Cook on the Resolution, while Kahekili visited Clerke on the Discovery(Kuykendall and Day 1976:16). When Cook sailed into Kealakekua Bay on January 17, 1779, Kalani'opu'u was still fighting Kahekili on Maui. At this time Kahekili's brother Ka'eo-kulani was ruling chief of Kauai; Ka-hahana was ruling chief of Oahu and Molokai; Kahekili'ahumanu of western Maui, Lanai and Kaho'olawe; and Kalani`opu'u was ruling chief of Hawaii and Hana Kamakau, 1992:84-86, 92, 97-98). On January 25th Kalani`opu'u visited Cook again at Kealakekua Bay, presenting him with several feather cloaks. In February Cook's plan to kidnap Kalani'opu'u as a hostage was thwarted and Cook was killed following a skirmish over a stolen cutter(Kuykendall and Day 1976:18). Following contact with Westerners, the population of North Kohala declined significantly. According to State Statistician Schmitt (1977:27), between 1832and 1835, the population in this area declined 26%. This decline was due in large part to the introduction of diseases by the early visitors.This decline accompanied a shift in settlement away from the leeward coasts to the interior and to windward areas. The economy of the islands experienced change as industry and capitalism emerged. The sandalwood trade was established by Euro-Americans in 1790 and by 1805 had become a burgeoning enterprise (Oliver 1961). By the 1820's, the sandalwood trade was wreaking havoc on the commoners who were weakening with the heavy production, exposure, and famine just to fill the coffers of the ali'i who were no longer under any control constraints (Oliver 1961:261; Kuykendall and Day 1976:42; Bushnell 1993:212). The lack of control of the sandalwood trade was to soon create the first Hawaiian national debt as promissory notes and levies were initiated by American traders and enforced by American warships (Oliver 1961:261, 262). "In the 1820s, the sandalwood trade was at its peak and every tree found was cut for its value.The forests of Kohala,which reached almost to the Kawaihae shore as late as 1815, contained an abundance of the coveted wood, presumably the dry land species" (n.a. 1967:16). The Hawaiian culture was well on its way towards Western assimilation as industry in Hawaii went from the sandalwood trade, to a short-lived whaling industry,to cattle ranching, and the more lucrative, but insidious sugar industry. Sugar cane was grown on all islands and when Cook arrived, he wrote of seeing sugar cane plantations. The Chinese on Lanai are credited with first producing sugar as early as 1802; however, it was not until 1835 that sugar became established commercially, primarily to replace a waning sandalwood industry (Oliver 1961:263; Kuykendall and Day 1976:92). In the 1840s, political acts of the Hawaiian Kingdom government would change the land tenure system in Hawaii. All lands were segregated into one of three categories: "Crown Lands" owned by the occupant of the throne, l Government Lands" controlled by the state, and "Konohiki Lands" controlled by the chiefs; and "were all subject to the rights of native tenants" (Chinen 1958:29, Beamer 2014:143). In 1846, King Kamehameha III appointed a Board of Commissioners commonly known as the Land Commissioners, to "confirm or reject all claims to land arising previously to the 10th day of December, AD 1845." Notices were frequently posted in The Polynesian Moffat and Kirkpatrick, 1995); however, the legislature did not acknowledge this act until June 7, 1848 (Chinen 1958:16; Moffat and Kirkpatrick 1995:48-49) and the act is known today as The Great Mahele. In 1850, the Kingdom government passed laws allowing foreigners to purchase fee simple lands (Speakman 2001:91). The Kuleana Act of 1850 allowed for fee simple land ownership by commoners. 111 The Waihona 'Aina (2000) Mahele Database; which is a compilation of data from the Indices of Awards (Indices 1929), Native Register (NR n.d.), Native Testimony (NT n.d.), Foreign Register (FR n.d.) and Foreign Testimony (FT n.d.) provides information on the Land Commission Awards (LCA) during the Mahele. This database indicates that I HAUN & ASSOCIATES 15 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 two claims were made in Puakea Ahupua`a. LCA 8746 was claimed by Keawe and LCA 8879B by Kamalamailalo. Only LCA 8879B was subsequently awarded. The location of this LCA is not depicted on available tax maps of the area. LCA 8746 and LCA 8879B are presented in detail in Appendix A. LCA 8746 to Keawe describes an enclosed house lot with two houses, in the 'iii of Laleakone with two houses on it surrounded by public land. The land passed from Keohokalole to Kekuannui and from Kekuanui to Keawe. LCA I8879BtoKamalamailalodescribesafencedhouselotwithfivehouses, three of which were owned by Kamalamailalo and two that were owned by his father Kaulemamoku,The land was owned by Kamalamailalo since the time of Kamehameha I. IThelandofPuakea (and the surrounding ahupua'a) were divided into land grants between 1852 and 1862. Figure 14 is a portion of Lydgate's 1893 Hawai'i Register Map 1705 showing the project area obtained from the Archives Division of the Hawai'i Department of Accounting and General Services (http://ags.hawaii.gov/survey/map31search). This map indicates that there are nine grants in Puakea Ahupua'a. Table 1, compiled from information obtained the Waihona 'Aina (2000) Mahele Database indicates that these grants ranged in area from 18 to 320 acres. According to Figure 14, the majority of the Puakea Ranch Headquarters area (TMK: (3) 5-6-001) is situated IinGrant2361toHenryChristenson, with a small portion located in Grant 1999 to Kahionamaka. The present project area is located in Grant 2361. Table 1.Land Grants in Puakea Ahupua'a I Grant Grantee Ahupua'a Year obtained Grantacreage 744 Paahao Puakea 1 1852 _ 50.2 745 Kaniho Puakea 1852 18 I 1549 Kaluhilau Puakea 2 1855 24.7 1550 Malamailalo Puakea 2 1855 88.5 1958 Papa Puakea 1855 19.32 I 1999 Kahionamaka Puakea 1856 107.65 2361 Henry Christiansen Puakea and Honoipu 1857 320 2777 Henere Puakea 1861 32 III 2848 Henry Christiansen Puakea,Honoipu and Lahuiiki 1862 77.3 By 1858 at least 2,119 foreigners lived in Hawaii. Many were merchants who traded and provided provisions, I ranchers and missionaries, who lived in various locations throughout the islands. "Foreigners engaged in agricultural pursuits with the idea of reaping a profit from the land, in contrast with the Hawaiians, who carried on...subsistence agriculture" (Coulter 1971:11). In the 1860s, the U. S. Civil War brought about a boost for the sugar industry in Hawaii as sugar plantations in the South were boycotted or destroyed. And while Rev. Lorenzo Lyons was busy building churches; Imiolo in Waimea, Hoku Loa at Puako and one at Kawaihae (n.a. 1967:18-19), Rev. Elias Bond was getting involved in the sugar business.Ill In 1860, Rev. Bond engaged his "long-time acquaintance" (Stephenson 1977:7), Samuel N. Castle in founding the Kohala Sugar Company on lands owned by Bond and his neighbor Dr. James Wight. The first crop of the Kohala Sugar Company was harvested in January 1865 (KTF 1975:69). Kohala's transition was a reflection of what was II happening elsewhere in Hawaii, as the sugar industry grew. The industry brought in tens of thousands of laborers from Asia, Europe, the Americas, Oceania, and Africa to work on the many plantations and mills that were being 1 established on all major islands (Oliver 1961:123). Bond's influence on the expansion of the Kohala sugar industry is described byTomonari-Tuggle: When Elias Bond directed his efforts to initiating sugar as a major agricultural industry in Kohala,he could I not have foreseen the incredible success at his modest venture.His primary concern was to develop a 1111 HAUN & ASSOCIATES 116 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 I N' \ ( . / s" i /• 7 t Allie-Ast ` `, f111pp i,/,:-. 17e1,11-/ E.t ill: 14,..;:c.: 1 /*--"Vi ;1 u. v,. moi, - • s.'/ im A go. , ., /N/, // ."::::: 44.H4'.,#) '')/ ' -,,,/ I 4se . g f v / / o e:q / e , 17I' t' I E I/4 Y w / 00s o y V ' 1 n z / 4 /I Q / iv r ` - // 1 / I i— i 1 iff, 4th/ 11*. k4 Z'" i r v, s y r yst.;T 0 0 / 1 -1 / / I p 4 yo I cz A 1 O. iJS i1. A n b J ' earte 2 m t o a i k/ 4/4 q !, at VI co i 44,4. triv4 t/ ao o N „....,.., .p° co 444444W o: a dAMr.• opo HAUN & ASSOCIATES 117 p I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 means for Hawaiian people of the district to compete successfully in the market economy that had evolved in Hawaii.What resulted was a vigorous,stable,and competitive industry which survived over a century of changing economic situated. For the Hawaiian people, however, the impact was not what Bond anticipated. The "triumphant march" brought along not merely a strengthened economy but a new and prevailing resource,the sugar industry,which abruptly interrupted the process of indigenous adaptation to Westernization and instituted fundamental changes to the demographic composition of the community, to the organization of settlements,and to the patterns of land use.Kohala during this 50 year period was a frontier community characterized by a variety of people, settlements, and commercial ventures. Newcomers to the district were filling an economic void with numerous and diverse endeavors, from which only a few would emerge successful.The void presented a challenge and what already existed in the district was insignificant in terms of what could potentially develop. The nature of the community and the organization of land were drastically altered. The Hawaiian population, already decimated by disease and outmigration, was insufficient for the needs of market-oriented agriculture, and waves of immigrant labor from the Orient, Portugal, Puerto Rico, and the Philippines arrived. Americans, British, and other northern Europeans came as managers and administrators.All were pioneers, leaving family,friends,and homes to seek better lives in the Kohala sugar frontier. The sugar mills and their associated plantations held a collective preeminence as major agents of Ichangeanddevelopmentinthedistrict. Kohala Sugar Company, Bond's model for economic security,was incorporated in 1863.After a decade of struggling,the company finally showed a credit balance in 1872,which coincided with the Reciprocity Treaty of 1876 between the United States and Hawaii. Although Bond maintained a paternal watch over the welfare of his congregation of laborers, his influence in the operation of the mill and plantation eventually waned before the demands of the profit-motive and his increasing age. By the time of Bond's death in 1896,the company was flourishing and completion had arisen in the form of five other sugar mills.Spurred on by the Reciprocity Treaty,sugar pioneers saw the potential of commercial development in Kohala. Dr. James Wight, one of the early haole residents of the district,stated the first of the other mills in 1873, at Halawa. In 1874, Union Mill and Plantation Co. started by the Hinds of Maui and later headed by James Renton,was set up in Honomaka'u.Judge C.F Hart, formerly of Kona, moved to Kohala to start Niuli`i Mill in 1877; originally milling native- grown cane, he soon expanded into a field operation as well. R.R. and John Hind moved to Hawai after selling Union Mill and set up the Hawi Mill and Plantation Co. and its two sugar-growing subsidiaries, Puakea and Homesteads Plantations, in 1881. In an effort to improve operations,the Hawi Company constructed the Hoea Mill in 1904,Star Mill in Kapa'au, operated only briefly in the early 1880s.(Tomonari-Tuggle 1988:40-42) Figure 15 is Tomonari-Tuggle's(1988:41)map of the Kohala region in the later 19th Century depicting the above mentioned camps and mills. This map indicates that the project area was not under sugar cane cultivation. The burgeoning sugar industry also resulted in the development of a rail system used to transport the cane from the fields to mills. The demands of the successful sugar production stimulated the formation of two supportive enterprises. To service mills,the Hawaiian Railroad Company,started by S.G.Wilder in 1881 and completed in 1883, ran from Mahukona to Niuli`i over 17 trestles and almost 20 miles of rail. Previously dependent on ox- cart transport of cane to landings at Hapu'u Kauhola Pt.,and Honoipu,the mills,with one exception,now HAUN & ASSOCIATES 118 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 -022019 I I HOU A MILL 40CA U1.0I404... 1014ALA 1.0104 1 f406/01,164 1.14D4. i.,i,......-v1:•4",;11"v1,1NION Allir .,., 44.. arl 4ARteW LNDC4. Projec i4041111,11111U114 KOKAM KO•40t....t areaMILL.Aoi.. •.KEDKCA LNDA I 0 Ptur.eA RANG!!• • 0-.; awAwi •••••••• MILL. UNIV., Ka, STAR( HALAWA 0*. id taw,* •4 ii4tut..o'1 Mt U.411" A Ntwu'iz- L6::••. i.*:,- - • - I 41,... :.,..\ 1 0 c.c... I otilatIKONA i 5HGAR. FIELDS o w•Use.oit.mat Gentr....,Met • rave tereGe.Meteor( / e 1 i Wit NUL allitiC.M 1 I/ I I Ics 1004iiik WICbl r 1 t I 1* INURE, 6. NORT14 4014ALA IN Tl4E. i LATZ. I9th Cr.Kruzy I A .5t44Al2. miL.L. I TOwN RAILROAD 6TATION II LAND tNCI rtf.•40 et PATH s Z. 4II0. 0. 10.rii_.......... 2110... sz. co i CM 4..4.• p,AILszyky 41 Q NI MAP ?Sy L.NroNS (ie.14). I Figure 15.Map of the North Kohala District in the Later 19th Century from Tomonari-Tuggle(1988:41) I HAUN & ASSOCIATES I 1 9 I I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 had efficient access to a landing at Mahukona on the sheltered lee side of the district. Hawi Mill continued to uses its landing at Honoipu. In 1884,the rail company carried 20,000 tons of freight and I6,000 passengers (Best 1978:43), proving itself a viable and nearly indispensable means of transportation. At the end of the century, the line was purchased by a conglomerate of plantations; again Hawi refused participation,although it eventually joined in 1912.(Tomonari-Tuggle 1988:42)1 In 1897,the Hawaiian Railroad Company was dissolved and a new company,the Hawaii Railway, was incorporated.The Hawaii Railway was sold in 1899 to the four Kohala sugar plantations that it served (Union Mill, Halawa Plantation, Kohala Plantation,and Niuli'i Plantation).The Hawi Mill and Plantation preferred to haul cane by wagon to its landing at Honoipu until 1912 when it also purchased a share of the railroad. Passenger service by the railroads ended by 1920 as automobiles became more common. The Hawaii Railway was dis-incorporated on 1937 and reincorporated as the Mahukona terminals.The railroad was eventually abandoned in 1939 (Best 1978:42-48). As indicated in Figure 15 the portion of the railroad in Puakea Ahupua'a is located approximately 1,100 meters seaward ofthe project area. Not everyone was in favor the railroad and its impact the community.Conde cites an 1882 letter from a farmer whose land was being: ruthlessly destroyed by the railroad overseers of S.G.Wilder.This act is equal to that of plain murder, Ibecausethelivelihoodofmyselfandmyfamilyisreducedtonothing,that is. My plants and that of my family are covered with dirt, the taro, banana, ti leaves, coffee, mango, orange, bamboo, and other plants.My property is filled with fruits,but these days it is reduced to naught.(Conde 1971:40) The expansion of the Kohala sugar industry in the 1920s and 19305 required a significant labor force and immigrants primarily from China and Portugal began arriving.The camps where the immigrants lived were typically located in close proximity to the fields so that the workers could walk to work (Schweitzer 2003). In order to supply the needs of the burgeoning immigrant population a variety of associated business emerged. The population of the region went into decline, due in part to young people being lured from the country to larger I towns and cities, especially Honolulu. Between 1940 and 1950 the population declined 17% to 4,456 people. By 1960,there were only 3,386 people in Kohala (Schmitt 1977:12). In 1975 the Kohala Mill closed its doors because of the declining population and disputes between the unions and management. As discussed above, Henry Christensen purchased Grant 2361 (location of project area) and Grant 2848 in the interior of Puakea Ahupua'a and surrounding areas (see Figure 14). A sheep ranch was initially established along 111withsomesugarcanecultivation; however,the latter was unsuccessful due to the crude equipment available at the time(Henke 1929:41). Christensen's lands in Puakea and Kukuipahu were purchased by Dr. James Wight around 1875 who subsequently 1 established a sugarcane and ranching operation on the property. Dr. Wight settled in Kohala in late 1840s after a ship he was traveling on wrecked off the coast of Mahukona. He operated a drug store in the area and also served as a Circuit Judge between 1852 and 1863. He was later was elected to the House of Representatives and subsequently to the House of Nobles under the Hawaiian Monarchy(Clark et al. 2013:31). Dr. Wight obtained a substantial interest in the Kohala Sugar Plantation and established another plantation in Halawa. He constructed an animal powered mill at Puakea According to an article in The Pacific Commercial Advertiser (precursor to the Honolulu Advertiser) a total of 1,118 tons of sugarcane were produced at Puakea in 1919 with an estimated 1,050 tons to be produced in 1920(Figure 16). HAUN &ASSOCIATES 120 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 I s THE PACIFIC COMMERCIAL ADt f 1 Arland x . .. •4 ':.rte., ` . , _ i, i Shipments To First t I. of Month, 39,493 Tons Sbt!ria."nit of 14:Mi /111317.1431.114, 011: 1‘..17.,MIakulioua.krhfaaro 4,for San Foams 1 to Fob oar. 1 totol*d t0. :otk th. fallowitg Int Aipmewto:eomper.d Wilk 64,k33 tone shippa,i to j Peahen, 100 town to Weween; Union Frt.ruarr I, 11114- The following tuba- Hill. 11i1: Haat.6f2,'Yr two las: be" inline will+hors the shipment.fur ritesI lag to Crockett. The Annie Johnson's 1 yenr classified: et.ruo totaled 1090 to.,, IWO Intl The hIrrims *tenser Kaebes. milieu;Sugar Fa•.i.as . 35,739 5$.647 Februarys 7,took 611 tune for C:orkett. t Wow ern . 1.401 4,00/1 The Mat•onio took(1421)tun,to 1'rorkett i Helloed . I,I71 2.0011 aid SAO tone of refined. t Loadings In Neal htura Total ........ 30.143 64.95.; !Helmut.. to sail in the arae future Shipments site* February I lordwilll. d at ports and take ..1,,i meet., !Iron. Western Tama,2.143;Farten'. approrim*rely a.follows: 1003:; refitted. 530—a aruwd to'al tr tihoietta Port Allen. 3000 tons to' !` dale of 3 40Wasters;3 ions,of whirl 2403 tons Manor.H so'w`n and Kaba'at.. is refined. allot .1000 tow.: Rll,era.to. Honolulu Oiaa'e *lest Illagalleit and Mnbukona,3200'ars.port Western; d System p lmillshart%hiptheir I3200,rat Meriden. Kahului. all Wes•ern.' ! meat.entre the last report•week ago The s•ze of the Maas'*eargo is serer. Mae writ 113 ton.by the Maters Crum tato. re M.••oaia,whir,sailed from HmonolaThefollowingtableshow.Ainests) h.Wednesday:portiere*hipped its first to F,•hreors I by ploatatioas freciAe i lot by the Yatsntie,1200 tone:red rho Prouty Mill iarludea Hosok ..; lair in,' i rtnutHelenaenhnerAnnieJ.din.. . front eludes Knots, Agriettitural I.teoapm«wt. sw_*,E.tl.o.t . r.,t'.t, I l.te t'MpHAWAII Obs tarp, Ca- 144. . 1 m. 11 tM 1 t lIllo a INN r`a.. . tun iters Mourn( nape ran . ...... t 4'nou H eanor Pe ro.. Ltd. ....................Aur 1!Z. flaoarn MAI*re. ta:r ...... 19,4Uonebanotortso. . ._ j(fr,s.utw Mpr rM LWm* .— hobo).. Mans.).,. Co 197101 .,, to 1%W A*t'aaa.wre Saga?r'a 12taa lei r+yu+t 1/1411./.1 101/yr 4'. t.r9 lata 0002 qHMs 11111 t'r Lasa It Wr !Paaot. Sweat 1•hwt.tl,.n s'w .7.0. a Yr urSepr 1`a.r,. 11.ala 11,M) tear MIII t.. ..............,. 724 1 11.111 ?4111 nod PMwtsti..n 1.3114 ,,...... Alan Itatnaa 19awlatmey 3,110 , Kcresta*lease 1'., Sfil4 ..., .., *.SCI 11i roles Mt'l `. Howl 111/1 Awl Pt.r.t.lran - Nan , t K..k.e .. 4. a.lemp*l 70.SAY 1.101Kavalore. t rr ted tae I. liX.y o.gd.-.knraMt Co..' MOM 2 7 14.0. Told .......................... 1S1 21/11 NMIg. Figure 16.February 13,1920 article from The Pacific Commercial Advertiser(from newspapers.com) According to Henke's A Survey of Livestock in Hawaii, the history of the ranch is described below: Dr. James Wight acquired the Puakea Ranch lands about 1875 and continued with the sheep IIIranch, the sheep at that time numbering about 7000 head of the Merino breed. Robert Mason acted as manager from about 1875 to 1882 and was followed by Hans Martinsen,who continued till 1886,when J. H. MacKenzie became manager for Dr. Wight and continued to 1901. Dr. Wight about 1886 imported two Maltese jacks at a cost of$1400 and he was probably one of the first men to breed mules in Hawaii. I HAUN & ASSOCIATES 121 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No 1510 - 022019 Since the sheep suffered from scab, and wild dogs killed many, cattle were substituted for the sheep in the eighties and there were few or no sheep left after 1890. Two Shorthorn bulls were imported from California and bred to the native cattle and Shorthorn blood predominated on Puakea Ranch till 1901,although some Hereford blood was introduced as early as 1889. Beef had little value at this time and many cattle were sold as work oxen for the cane fields. While Mr. MacKenzie was manager water was brought eight miles from the Kohala mountains, some wells were dug near the beach and some fences built. When Arthur Mason became manager in 1901 the ranch had about 3000 cattle. During the next twenty years Hereford blood gradually replaced the Shorthorns. Eighteen Herefords, eight bulls and ten cows were imported from Oregon in 1908 at a cost of$130 each and five bulls were imported from Kentucky in 1920 at a cost of$500 each. (Henke 1929:41-42) Following the death of Dr. Wight on September 2, 1905 at the age of 91. The ranch was operated by Robert Shingle, E. H. Wodehouse, and A. W. T. Bottomley, trustees for the James Wight Estate. According to Adams and Athens (1994:18) by 1910, 8,758 acres of land were under the control of the Puakea Ranch. Water to the ranch IandsugarmillweresuppliedbytheKohalaDitch, which supplied several plantations in the area emptying into a reservoir in Puakea. The supply of water was inadequate for the successful cultivation of sugarcane and the last cane crop was harvested in 1930. (Clark et al. 2013:31). 1 According to Henke, the Puakea Ranch also included an area formerly known as Puuhue Ranch (1929:40). "The headquarters of the Puuhue Ranch operated as a separate ranch previous to about 1906 when an amalgamation with Puakea Ranch was effected which will expire in 1930..."(1929:40). The characteristics of the combined ranches are described as follows: These combined ranches run from the sea to an elevation of about 4000 feet and have a total I area of about 25,000 acres and at present have about 5000 Herefords, 350 light horses and 10 Berkshire sows. Good Hereford bulls as well as females have been imported from time to time and the ranches at present have 85 range bulls and 75 selected females that are bred to specially good bulls for the production of the range bulls. The range bulls are segregated from the cattle from July to February. The rainfall at the Puakea Ranch headquarters has varied between 30 and 63 inches since 1920. The water needed for the cattle comes from the Kohala mountains. Paspalum dilatatum has been planted quite extensively and has done very well. Koa haole Leucaena glauca) is being experimented with as a promising low land forage crop. Pigeon peas ICajanusindicus) have not been extensively tried,although results of such attempts as have been made with this legume have not been too encouraging. Plenty of Bermuda grass (Cynodon dactylon) and some red top (Tricholaena rosea) is found on the lower and intermediate IelevationsandHilograss (Paspalum conjugatum) is quite abundant on the upper lands. A scattering of Ohia lehua trees is found over the upper section with practically all their branches on the leeward side of the tree, which is indicative of the strong winds that prevail much of the time. The ranches are in need of more fences and paddocks to facilitate segregation and control of the11 animals at different ages and to give newly planted grasses an opportunity to get started while 4 HAUN & ASSOCIATES 122 I TMK : ( 3 ) 5 - 6- 001 : Por . 082 Report No . 1510 -022019 Ithe cattle are kept out of certain sections for a time.These paddocks are included in the plans for the development of the ranches. PP Cattle are marketed from two years of age to about five, at which time they weigh about 450 to 650 pounds dressed weight. About 500 to 600 are shipped to Honolulu annually, with an additional 180 slaughtered on the ranch for consumption in the Kohala district. Cattle for Honolulu are loaded at Kawaihae. The Mahukona beach is not suitable for loading cattle on the Inter-Island boats. It is planned to reduce the number of horses which are kept for sale to various parties. No mules are produced on the ranch at the present time. (Henke 1929:41) As many landowners did, Dr. Wight brought in laborers to work the land, contributing to a wave of 185,000 Japanese immigrants who came to Hawaii in the 19th and 20th Centuries (https://keolamagazine.com). Zenjiro Kawamoto and his wife Wasa Watabayashi immigrated to North Kohala from Hiroshima as part of the wave of Japanese immigration. They settled at Puakea Ranch and moved into what would eventually be called the Cowboy House" (see Figure 20 below). The Kawamotos raised three children at the ranch; Masato (Johnny), Yoshio (Yoshi), and Thelma. The family went on to oversee the operations of the Puakea Ranch for four generations. The Parker Ranch began leasing the Puakea Ranch lands from the James Wight Estate in 1932,agreeing to a twenty year lease agreement for a fee of $2,500 per year. The lease of the ranch land is memorialized in a February 9, I 1932 article in the Honolulu Advertiser (Figure 17). Richard Smart of the Parker Ranch eventually purchased the Puakea Ranch lands outright in 1944 (https://puakearanch.com). willil.a..sats,,. I PARKER RANCH BUYS KOHALA CO. I LAND AND STOCK Tha d11* b co on HawaiiboaDespt=eboo d by the r rre t.r at• I,I Weal Is bp Masa,tad Webs,* IsammineS.rmr tIYrslO at the PoshseekKmaiUMWalet••00dateadNfts.ynne..epo,T. }veer namb la eerewed hfePPtobmpety ?-fqp .Q0..•.. e.n of the p tnrandIIIIrdoftittle. 1 The: ren, Mer..hrs r..f,ImNum wUNMYetrw14Iketank.?= llama Maooww4_a Rase of sleet. MIMI W. Cann w ovlle w pre-nnrgtf rot tar herr erekIliadtwlrIss.trrw Ote*Ir swell=rasa. 11 Y ear Ire We/trete w PM-all=wenn wise miler as erdtr. irrr rwfrw-. N. ruler rIIsMpg=Isle tin left L a.1111010.110.At.It.srlMrt relapII.tom,The rwarvhtp mowed .lana eMer/ew at that now N./rteilli0wettotnrMOMIOIMS. I/ YrMisr part of tql tr e0.7esr at taw hakes `reeve•r theo Kahan, ante as • aettIstl11Ws Leer Op..aa lacerporstelleaeerphte.MC Ad IN Star e[ Ur ealnal+ofOftfwrgrasMaysIllealkOe. Itette et tie wiptWItreePeaks* iamb par/MAW Figure 17.February 9,1932 article from The Honolulu Advertiser(from newspapers.com) IIFigure 18 is a portion of the USGS 1930 Hawi quadrangle showing the location of the project area and the Puakea Ranch headquarters.The headquarters are situated on the mauka side of the historic road that follows the path of the current Akoni Pule Highway. The map also shows a road extending seaward to Honoipu Landing and the II HAUN & ASSOCIATES 123 p I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 railroad extending throughout Puakea Ahupua'a at approximately 170 to 200 ft elevation. A cluster of buildings is located inland of Honoipu Landing and three houses are present mauka of the railroad line. Figure 19 is a portion of an aerial view of the project area vicinity taken on December 20, 1976 by the U.S. Geological Survey and obtained from the University of Hawai'i at Manoa online library http://magis.manoa.hawaii.edu). This photograph shows the extent of the Puakea Ranch headquarters at this time. 1 In the 1980s the Parker Ranch subsequently sold 200 acres of the Puakea Ranch lands to a real estate developer and the Kawamoto family and other ranch employees were asked to relocate. The Puakea Ranch headquarters,111includingthepresentprojectareasubsequentlyfellintodisrepair. The Puakea Ranch headquarters was purchased by Christie Cash and her partner James Nelson in 2005. Her desire was to create a "low impact, eco-minded, low-density place for families that was an alternative to the resorts." https://keolamagazine.com. She took great efforts to restore the ranch buildings to their original condition and today the Puakea Ranch provides overnight accommodations for tourists.The area was informally recorded by the landowners in a June 2009 National Register of Historic Places form (Appendix B). The ranch buildings were subsequently assigned SIHP Site designation 50-10-2-9071. The current extent of the facility, comprising the 32.4 acre TMK: (3) 5-6-001:082 is depicted in Figure 20. The buildings consist of following: The Saddle House, James Cottage(built 1920s),The Cowboy House (1880s),The Toy Box,The Tool Shed,The Chicken Coop,The Tree House, Yoshi's House(1940s)and Miles Away(1930s). Previous Archaeological Research A considerable amount of archaeological research has been conducted within Puakea Ahupua'a, including the entirety of the portion of the ahupua'a seaward of the Akoni Pule Highway.These projects,totaling more than 750 acres are shown in Figure 21 and summarized in Table 2. Not included in the figure or table are the Statewide Survey of Historic Places survey that extended along the west coast of Hawai'i Island and the historical overview of the North Kohala district by Tomonari-Tuggle (1988). The sites identified during these projects were subsequently documented during surveys by Bury et al. (2006), Clark et al. (2013), Rosendahl (1982a, 1982b) and are included in those entries. The prior archaeological studies in the area indicate widespread disturbance associated with historic cattle ranching. Despite this disturbance, 60 sites have been documented. This equates to an estimated density of 13 sites per acre. Between 1982 and 1993 a series of field inspections, reconnaissance surveys and excavation projects were conducted of a 440 acre parcel that extends from the shoreline at Honoipu Landing inland to the Akoni Pule Highway. These projects were conducted by Barrera (1984, 1992, 1993) and Rosendahl (1982a, 1982b, 1984). These combined projects identified a total of 22 sites comprised predominately of pre-contact to early historic habitation sites, along several agricultural and burial sites. A portion of the historic railroad grade that extends through the area was also documented. HAUN & ASSOCIATES 124 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 -022019 ir-FP;Z„,,,,,viltic :,,, ,'. ' ,,,,,...,,-. ' c)..: 0, , N,f/A"dr: ..*A.--:- z11., 0 k ilop,\I s , it rt.... .r0,- -,49,,,, ''' %N..'--"--,. : 11, 7 s‘ (if 0„,;-?'1._,4`.-,ISNI Odr L'h-\,'‘' '-Adivi—- . : i - ai. 6.4:. _0%. ..,:,.., k:‘, ...„_t. ,.‘ r-git '111 N ' \\„Lz---,--'''-';•"--, n t."- . 11‘ V 1..'-''''''. 4'.'*.s.." ' 0 iirsiir --i• .'ttz. •, • ii-.. i.;, ...6;.t.,,....v - . ditck; 4.:‘,,,,,`~ .' ' i; . - L,,, _ ..,, Ar 7.,..,...,dp-..;' lkilP erti 7,1,10;.‘ 4:...-r.,, isriligi: % a 4,.i.istki.2:\:,..*‘ V:. 0.,•••. iiir,..., N,... 000mk... ...... fi, 71%^'": 40,17: i....,...:,..,,_ ‘,.. tiii .. 4,,,...z,H.7,,,,\,,77: v , liiiHNI IV 1,144'\,Allr-' 400111007: ir x . 41.--,744—4,-.1‘,.. i IIN 114,_ q , N.- -4410%.„...1,. ,----,:„. - kw, , ...... Pb y `*.... moo Th. w fa IfiVi• ; ,.:\:‘ 4"....„„,\ '''. ink,I 7'47;'' .4. 1\1,i% .-:,,,:- N ...:". ......":...."-'--.."- --- '''''*.?.'"."."\ ''''' i:'-' 46"1 Z4i;:.:.ks,, \Nii: \\.,,, _ _........ ............",„...,,.. i.1/4,. a. 40 i to V:'' t_ VI c0 10 4 H t V s., i to Oa 1 co v 300 LL HAUN &ASSOCIATES 125 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 022019 r 1 1 1 C V Ov Vy Q a 0Q 0. CID0 O O. N op HAUN & ASSOCIATES 126 I I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 f a ' j r n' i 1 xAW'. {TAT[ J 1TDttc Rr1.rtR APRt no,rt , EIIT;f on., l72eryg Jf yratTA6LF fjAAptN TTAwEA.g +>r lj I OAnri ar.AM>,w} v°COwpti HmitE c lye, t an l , i i she r:N tcx HMmt RUT Px +:o=,m A. I grr(v C Cart r [' 8VA c ,L t I I rs r nrCA.may0- T ' Pre}ct awes t11P aEr tmA4U-,AUIEO YONE)I I r eE i wow p 7 firIi 1 I may: 1)VArEA ' w CIL"blrYNATIVEtivoitrAga At)I i X01.. I I I rural{wiA.0 PPns^Tt NAw,W.wA. WV II Figure 20.Current extent of Puakea Ranch Table 2.Previous archaeological work in Puakea Ahupua'a and surrounding areas Author Ahupua'a StudyType* Elevation(ft Acreage No of Historic useAMA) sites Bury et al.(2006),Clark sial. Puakea and Kukuipahui Archaeological Inventory 0-200 78.4 25 Cattle ranching2013) Survey Field inspection, Barrera(1984,1922,1993),Puakea and Honoipu Reconnaissance, 0-550 440.0 22 Cattle ranchingkiRosendhal(1982a,19826,1984)Excavation Clark and Rechtman(2005) Puakea and Kukuipahui Archaeological Inventory 200-500 215.0 13 Cattle ranching I Survey Corbin and Rosendahl(2006) Puakea and Kukuipahui Archaeological Inventory 450-550 24.6 0 Cattle ranchingSurvey Tota' 758.0 60 I HAUN & ASSOCIATES 127 I TMK : ( 3 ) 5 - 6- 001 : Por . 082 Report No . 1510-022019 UpoiuArport --r m \ rir \1 1 Limukoko Point N VI. rN N y V 9 A IIIUpotuAirportRoad-\ T ef 7..-s-, 9 \ 7 \ N 4 i \ 4,,\\ LOGO 0 \ I \ c \ q G 2 FA \ Honuipu Landing N. to "N.\y r\ Puakea Pana--j gyp I \ lO1t Ba'rrera(1984 1992.1993) t--—tiaana Bay a' CC\ 7 Rosendahl(t982a 19828 1984 N Akoni Pule H y \ HwY 270) fillPr hanaola Point Bury et ai.(2006) Clark et ai.(2013) -` A G 1OG 9 MKS(3) c.pr 1:R: N N. O a N. O, Clark and Rechtman(2005) tip A 8i> 40 c AV yogiN Project area \ s i Corbin aJosendah(2006) \\ kFN N N. s N1, KUKUtPAHU N...,•-.. A N N Keha:a[N N y ti1000 m S Akoni Pule Hwy Hwy 270) i ri gW Contour Interval=200 R Q 400 3>nort Ahupua'a Boundary Ditty tonne, I Figure 21.Previous archaeological work I HAUN & ASSOCIATES 128 I I TMK : ( 3 ) 5 - 6- 001 : Por . 082 Report No . 1510 - 022019 IClark and Rechtman (2005) conducted an archaeological inventory survey pf a 215 acre parcel in Puakea and Kukuipahu Ahupua`a. This survey area extended inland from the Bury et al. (2006) and Clark et al. (2013) project area east to the Akoni Pule Highway. Large portions of the area had been mechanically cleared for pasture Iimprovement; however, 13 sites were documented.The sites consisted of a platform,two habitation complexes, a habitation/resource procurement area, a modified outcrop/wind break, a complex comprised of a water tank, a I concrete water trough, and two foundations, a concrete survey marker, a cairn and five modified outcrops/alignments Bury et al. (2006) conducted an archaeological inventory survey of a 78.5 acre parcel in coastal Puakea, extending from the shoreline at Holana Bay inland to approximately 200 ft. Portions of this area were subsequently examined by Clark et al. (2013). A total of 25 sites have been identified in this area consisting of two survey markers, a I portion of the railroad grade that extends through the area, World War II Navy tower installation, eight pre- contact to early historic habitation complexes,three habitation enclosures and two enclosure remnants,two burial platforms,two alignments,a mound and three cairns. I The area immediately to the south of the present project area was surveyed by Corbin and Rosendahl (2006).The area is comprised of former Puakea Ranch pasture land that had been previously grubbed. No archaeological sites or features were identified during this project. IBased on the archaeological work conducted in the area,the majority of the habitation sites in Puakea are located along the coast. The interior portions, including the present project area are located along the northern fringes of the vast agricultural complex known as the Kohala Field System as defined by Tomonari-Tuggle (1988; see Figure II 13). L PROJECT EXPECTATIONS Based on historic documentary research and on the previous archaeological work in the area it is unlikely that evidence of the pre-contact use of the project area will be present. The historic use of the parcel will likely be Ievidenced by the remnants of the Puakea Ranch,consisting of historic structures, roads,and walls. CONSULTATION IIThe current landowner, Ms. Christie Cash has conducted extensive research into the Puakea Ranch and the people who called it home. In an October 24, 2017 letter to the architecture branch of the SHPD requesting permission to reconstruct several structures on the property, Ms. Cash provides insight into the Kawamoto family who oversawIIP the operations of the Puakea Ranch for generations,and a general historic of the ranch.According to Ms. Cash: Because these structures no longer exist and only foundations or ruins remain, we must rely on the oral history of Masa and Thelma Kawamoto who lived at Puakea and were both born at Puakea in the Cowboy House in the 1920's.As children,their mother worked for the family in the big house" and Masa described it as a large two story home with many bedrooms. According to Masa, many big parties and gatherings were held and his mother worked the parties as kitchen help. Masa and Yoshi would hunt pheasants for the parties and his mother would prepare them. He described this to me when he came to visit Puakea and teach me the history he could. fik From 1870-1928, descendants and relatives of James Wight of Kohala resided in the home and managed Puakea Planation and Ranch.The home was considered to be a grand estate and many I parties and gatherings were hosted at the home, as "The Society" was a very important part of the predominantly British culture of North Kohala Sugar's growers and Mill owners. Prominent Plantation Families of the time including Mrs. & Mrs. H. R. Bryant, Mr. & Mrs. James S. Wight, I HAUN & ASSOCIATES 129 1 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Mr. Robert Leighton Hind and Mr. & Mrs. H.P. Woods were all residences of the estate home from 1870-1940. Beginning in 1928-1932, management of Puakea was controlled Mr. John Hind, who was the 1presidentofthePuakeaPlantationCompany. Beginning in the 1930s, Parker Ranch also took a greater interest and control of Puakea. In 1944, Richard Smart purchased Puakea Ranch from the James Wight Estate where it had been part of the vast Wight Estate holdings beginning in the 11850s. 1 1 1 HAUN & ASSOCIATES 130 I TMK : ( 3 ) 5 -6-001 : Por . 082 Report No . 1510-022019 I FINDINGS I The archaeological inventory survey of the project area identified three features (Features 7, 10.1 and 13) of a previously identified site. As discussed in the background section of this report, the Puakea Ranch headquarters was previously documented by the landowners as SIHP Site 9071. A total of 12 features were recorded as part of I the site, consisting of houses (Features 1. 2 and 3), bunk houses, 4, 5 and 6), a garage (Feature 7), a slaughter house(Feature 8), a sugar mill (Feature 9),a series of rock walls(Feature 10), a network of corrals(Feature 11)and a saddle shop(Feature 12;Table 3 and Figure 22). IThe survey documented a modern building built over an historic concrete slab (Feature 7), a section of the Feature 10 wall, designated as Feature 10.1 and a newly identified concrete slab that appears to be historic in origin Feature 13). A chicken coop and a farm stand have been built on the Feature 13 concrete slab. The location of the Ifeatures within the 2.14 acre project area is presented in Figure 23. Feature 7 was originally described as a garage outbuilding on the NRHP form (see Appendix B). The feature is I located along the eastern boundary of the project area to the west of the Feature 10.1 stone wall. According to the landowner, at the time the form was completed, the building consisted of a concrete slab with the collapsed remnants of a rusted metal structure under a dragonfruit tree (pers. comm.). The metal framework was I subsequently removed and a wooden building was built on the concrete foundation (Figure 24 and Figure 25).This building currently functions as a tool shed. It is rectangular in shape and is 18 feet (5.4 meters) long (northeast by southwest) and 12 feet (3.65 meters) wide. Some of the materials used to construct the modern shed were Iscavenged from other structures on the property. Feature 10.1 is a stone wall that extends along the inland side of the project area. The extent of this wall is presented in Figure 23. The wall is part of a network of walls that extend throughout the Puakea Ranch area that I I were designated as `Building 10" in the NRHP form (see Appendix B).The wall originates at the northeastern corner of the project area, adjacent to a dirt road. It extends to the south-southwest for 252 feet (77.0 meters) Iwhere a 22 feet (6.8 meter)wide gap is located.The wall continues on the southern side of the gap for another 66 feet (20.1 meters) where the wall terminates at the northern side of the dirt road. The ends of the wall on each side of the gap and at the southern end are flared out. The wall continues to the south outside the project area. The wall evidences an overall length of 340 feet (103.9 meters) long, varying in width from 2.9 to 3.6 feet (0.9 toI1.1 meters) wide and 3.2 to 4.1 feet (1.0 to 1.15 meters) in height. It is built of stacked and faced boulders and cobbles with a core-filled cobble interior. Overviews of the wall are presented in Figure 25 and Figure 26. No Icultural material was found in association with the wall. Feature 13 is a concrete slab located to the northwest of Feature 7.The slab is depicted on Figure 22 map included Iin the NRHP form (see Appendix B); however it was not described or assigned a feature designation. The slab is rectangular in shape and is 25 feet (7.6 meters) long (northeast by southwest), and 12 feet (3.65 meters) built of formed concrete. A series of kiawe wood posts extend around the east and west sides of the slab. Several modern additions to the feature have been constructed at the slab (Figure 27). A chicken coop has been built on the slab over the southern portion of the slab with a farm stand located in the northeastern corner (Figure 28 and Figure 29).A pig pen and a chicken/rabbit pen extend to the south. No cultural material is present. IThe portion of Site 9071 in the project area is associated with the historic use of the Puakea Ranch. The Feature 7 slab originally functioned as the foundation for a garage and has been repurposed for use as a tool shed. The Feature 10.1 wall is interpreted as a livestock control feature likely used to prevent livestock from entering Ihabitation areas. It is unknown what the Feature 13 slab originally functioned as; however, it currently functions as the foundation for a chicken coop and farm stand. The portion of the site in the project area is altered and in fair condition. I HAUN & ASSOCIATES 131 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Table 3.Site 9071 features from NRHP form I Puakea Ranch Date of PatterRanch a Features Name on NRHP form name(see Figure Structure Description r t 20) construction inventory No. 1 Ranch House Yoshi's house 1940s 267 Built from materials salvaged from original home of James Wight I 2 Cowboy House Miles Away 1930s 253 Moved to present site from Mahukona 3 Cowboy House The Toy Box/The 1929 273 Paniolo style structure IOhanaHouse 4 Bunk House The Cowboy House 1890s 270 Paniolo style structure 5 Bunk House James Cottage 1920s 253 Paniolo style structure Bunk Rooms/Tool and I6 Supply Shed n/a n/a 7 Garage The Tool Shed n/a 8 Slaughter House n/a n/a Wooden structrue with concrete trough I9SugarMilln/a 1870 Stack collapsed in 2007 earthquake 10 Dry laid lava rock walls n/a n/a Network of walls present throughout project area 11 Fenced Animal Corral n/a n/a Networkof fences(wire and wood) present throughout project area ISaddleRepair/Storage 12 n/a 1940s Shed Listed as Building#on NRHP form not available I rts N• 907112 NaAi.. , 110N0 / I 071.5 Ina' els i90714a+•t 0 4 a14. r INSET 'A' I9071-13it rtm= 9oJ1a Java PlumLana Op OOO AOOOOQ)000000 iV41it ix aramilamenummommiiirs rIP a a 71O000000 00 00 9071-1 * 44 a !_ r 3,9071-7 E. wowfisww i 0 J 4 SIM s++ -'I-ayes s O 4• •AMiya itr` tW. 9071-,O.t j 4 h 0 9071-2 O mak, 9071-10=Walks Shan Puake:. I0010, 9071-11=Fences kt,Iroughout Puake iq cel ROCK WALLS Figure 22.Location of Site 9071 features from NRHP form HAUN &ASSOCIATES 132 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 I I g tD n no I41I14444\1" NINNIIIII'lIIII131414II1IIilIII:4141111411' 1/ 4Sir41*---.. /' 1/ oiC `.`,.,.o o f. NINN\ SINs 111111114111114N i N7,14. 1\\ i vc n f O 1 1 f I 7-71 a41 a i 0 0O z E E 3 a 0 3r e ,s m LL MN T. 00 LL 111 HAUN & ASSOCIATES 133 I TMK : ( 3 ) 5 6 001 : Por . 082 Report No . 1510-022019 I I I Itaa H a i r I n I IFigure24.Modern shed built over historic Feature 7 concrete slab(view to southeast) I rr`, g' 1,,*,,,,,3,l''''. ...,...,:, , ' 4, to, ' ,_4., i.,..! ,1 ''. .,* A Figure 25.Modern shed built over historic Feature 7 concrete slab showing Feature 10.1 wall(view to north) HAUN & ASSOCIATES 134 I TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510-022019 y I s. ii I ti - A-. 0IteR» lt" ,fie.2' i a r 1,.,,e't1 ' . 4. l''., , " lAIrs‘;;' k :4";,;', 1,,,j3t,:4,.1 1 tem 1 4,, i 0 -int, — le4(:.....- --. ' -. Alliii Y it y'" 7 fit z IFigure 26.Feature 10.1 wall(view to southeast) I the road wirefence Macadamia nut tree I I Concrete salt Farm stare 1 I i Ctucken coop II ell"u N I MEW o rs,..r 0 I Figure 27.Plan map of Feature 13 HAUN &ASSOCIATES 135 1 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 022019 lopporprr, „ 44 9: it 1 c I iiiii. 7, ,,,.....,. ,.. 1 b fr1__. Ifir, C I Figure 28.Feature 13 concrete slab and modern chicken coop and farm stand(view to south) s.S r:_'1....: 7......„.,Ii-p Y 1114 eftyam, I r yyy ,, t t 1.u- r "ir i i I I Figure 29.Feature 13 concrete slab and modern chicken coop and farm stand(view to west)I I HAUN &ASSOCIATES 136 I I TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510-022019 I CONCLUSION Discussion 1 The archaeological inventory survey results conform to the expectations derived from historical and archaeological background research. This research indicated that sites in the parcel would likely be limited to historic remains Lassociated with the Puakea Ranch. Three features were identified consisting of two concrete slabs that have been re-purposed for use as a tool shed (Feature 7) and a chicken coop/farm stand (Feature 13), and a stone wall Feature 10.1). Significance Assessments The site identified during the survey is assessed for significance based on Hawai'i Administrative Rules (HAR) §13- 11 284-6. According to (HAR) §13-284-6 (b), a site must possess integrity of location, design, setting, materials, workmanship,feeling,and/or association and shall meet one or more of the following criteria: I1. Criterion "a": Be associated with events that have made an important contribution to the broad patterns of our history; 2. Criterion"b": Be associated with the lives of persons important in our past; 1 3. Criterion "c": Embody the distinctive characteristics of a type, period, or method of construction; represent the work of a master; or possess high artistic value; 4. Criterion "d": Have yielded, or is likely to yield, information important for research on prehistory Ior history;and 5. Criterion "e": Have an important traditional cultural value to the native Hawaiian people or to another ethnic group of the state due to associations with traditional cultural practices once carried out, or still Icarried out, at the property or due to associations with traditional beliefs, events or oral accounts—these associations being important to the group's history and cultural identity. I The portion of Site 9071 in the project area site possesses integrity of location, design, materials, and workmanship.The previously prepared NRHP form indicates Site 9071 is assessed as significant under criterion "a" because of its association with events that made a contribution to the broad patterns of history (sugar cane I cultivation and cattle ranching), under criterion "b" due to its association with Dr.James Wight, under criterion "c" as an excellent site type example,and under criterion "d"for its information content. The proposed development will have an effect on the historic properties within the project area. The landowner Lproposes minimal impacts to the 2.14 acre project area, consisting of constructing an approximately 2500 sq foot space that contains an Americans with Disabilities Act(ADA)approved restroom, kitchen facility and a space for set up in an enclosed area.. The majority of the area will not be impacted by the proposed development and will function as an open event area for weddings and other functions; however, the Feature 7 and 13 slabs will be destroyed to make way for the ADA improvements.The Feature 10.1 wall will be preserved. The Feature 7 and 13 slabs are not integral components of the Puakea Ranch and functioned as minor elements of the facility. In order to mitigate their destruction, the proposed restroom will be designed in accordance with the Secretary of the Interior Standards for rehabilitation which is defined as"...the process of returning a property to a Lstate of utility, through repair or alteration, which makes possible an efficient contemporary use while preserving those portions and features of the property which are significant to its historic, architecture, and cultural value." NPS.gov.) The restroom will be aesthetically compatible with the other historic structures on the property, Iconstructed with board and batten siding and corrugated metal roofing. The restroom will be constructed in such a manner that if removed in the future, the essential form and integrity of the remaining historic properties and its environment would be unimpaired. HAUN & ASSOCIATES 137 I TMK : ( 3 ) 5 - 6 -001 : Por . 082 Report No . 1510 -022019 National Park Service, U.S. Department of the Interior website. 2018 (http://www.nps.gov) TRANSLATION OF HAWAIIAN WORDS' ahupua'a-traditional Hawaiian land unit usually extending from the uplands to the sea ali'i-chief,chiefess,officer, ruler, monarch ali'i ai moku—paramount chief heiau-Pre-Christian place of worship,shrine kapu-Taboo,prohibition 111konohiki-headman of an ahupua'a land division under the chief kuleana-small piece of property,as within an ahupua'a Ku—war God luakini-temple,or large heiau where ruling chiefs prayed and human sacrifices were offered Mdhele-land division of 1848 mauka—inland 1-from wehewehe.org HAUN &ASSOCIATES 138 TMK : ( 3 ) 5 - 6-001 : Por. 082 Report No . 1510 -022019 REFERENCES Adams,J.,and J.Athens 1994 Archaeological Inventory Survey, Upland Portions of Kukuipahu and Awalua, North Kohala, Island of Hawai'i. Prepared for Chalon International of Hawaii, Inc. International Archaeological Research Institute, Inc., Honolulu. Archives Division of the Hawai'i Department of Accounting and General Services. 2017 http://ags.hawaii.gov/survey/map-search Barrera,W.,Jr. 1984 Puakea Bay Ranch, Hawaii: Archaeological Survey. Chiniago, Inc. Prepared for Puakea Bay Ranch 1992 Partnership. Puakea, North Kohala, Hawaii Island: Archaeological Inventory Survey of Four Sites in the Conservation District. Chinago Inc. Prepared for Mr.and Mrs.George Issacs, Kapaau. 1993 Puakea, North Kohala, Hawaii Island: Archaeological Inventory Survey of Four Sites in the Conservation District. 1993 Supplemental Investigations. Comstock Cultural Resources Management Inc. Prepared for Puakea Bay Ranch Owner's Association and Mr.and Mrs.George Issacs. Beamer, Kamanamaikalani 2014 No Mdkou Ka Mona Liberating a Nation. Kamehameha Publishing 2014, Honolulu, HI. Best, G.M. 1978 Railroads of Hawaii: Narrow and Standard Gauge Common Carriers. San Marino, CA. Golden West Books. CA:Golden West Books. Bury, B., M. Clark and R. Rechtman 2006 An Archaeological Inventory Survey of TMK:3-5-6-01:108, 109, and 110, Puakea and Kukuipahu Ahupua'a, North Kohala District, Island of Hawai'i. Rechtman Consulting Report RC-0353. Prepared for Greg Mooers, Mooers Enterprises, LLC, Kamuela, Hawaii Bushnell, 0.A. 1993 The Gifts of Civilization: Germs and Genocide in Hawai'i. University of Hawaii Press, Honolulu. I Chinen,J. 1958 The Great Mahele:Hawaii's Land Division of 1848. University of Hawaii Press, Honolulu. Clark, M., B. Bury,and R. Rechtman 2013 An Archaeological Inventory Survey of TMK:3-5-6-01:109, Puakea ahupua'a, North Kohala District, Island of Hawai'i. Rechtman Consulting Report RC-0866. Prepared for Peter Vincent Architects. I HAUN & ASSOCIATES 139 I TMK : ( 3 ) 5 - 6 -001 : Por . 082 Report No . 1510 -022019 Clark, M. and R. Rechtman 2005 An Archaeological Inventory Survey of TMK:3-5-6-01:111, Puakea and Kukuipahu Ahupua'a, North Kohala District, Island of Hawai'i. Rechtman Consulting Report RC-0258. Prepared for Greg Mooers, Mooers Enterprises, LLC, Kamuela, Hawai'i. Conde,J. 1971 Narrow Gauge in a Kingdom.Glenwood Publishers, Felton,California. Corbin,A.and P. Rosendahl 2006 Archaeological Assessment Survey for determination of "No Historic Properties Affected", Puakea Private Residence Project, Lands of Puakea and Kukuipahu, North Kohala District, Island of Hawai'i TMK:3-5-6-01:85). PHRI Report 2633-062006. Prepared for David G. Hiester, Boerne,TX I Coulter,J. 1971 Agricultural Land-Use Planning in the Territory of Hawaii 1940. Agricultural Extension Bulletin No. 36 Honolulu. DLNR(Department of Land and Natural Resources) 2003 Hawai'i Administrative Rules, Title 13, Department of Land and Natural Resources, Subtitle 13, State Historic Preservation Division Rules. Day,A.G. i 1992 Hawaii and Points South:True Island Tales. Mutual Publishing, Honolulu. Ellis,W. 1963 A Narrative of a Tour through Hawaii. Originally published in 1917. Honolulu Advertiser Publishing Co., Honolulu. FR n.d. Foreign Register of Kuleana Claims Recorded by the Board of Commissioners to Quiet Land Titles in the Hawaiian Islands. Manuscript. Hawai'i State Archives. FT n.d. Foreign Testimony Recorded by the Board of Commissioners to Quiet Land Titles in the Hawaiian Islands. Manuscript. Hawai'i State Archives. Giambelluca,T.W.,Q.Chen,A.G. Frazier,J.P. Price,Y.-L. Chen, P.-S.Chu,J.K. Eischeid,and D.M. Delparte 2013 Online Rainfall Atlas of Hawai`i. Bull. Amer. Meteor. Soc. 94, 313-316, doi: 10.1175/BAMS-D-11- 00228.1. Henke, L.A. 1929 A Survey of Livestock in Hawaii. Honolulu: University of Hawai'i. l'i,J.P. [Translated by Mary Kawena Pukui; Edited by Dorothy B. Barrere] 1983 Fragments of Hawaiian History. Bishop Museum Press, Honolulu. [Original 1959. Translations of newspaper articles(Kuokoa)written in 1866-1870]. HAUN 8c ASSOCIATES 140 TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510-0220 : Indices 1929 Indices of Awards Made by the Board of Land Commissioners to Quiet Land Titles in the Hawaiian Islands. Territory of Hawai'i, Honolulu. KTF(Kohala Task Force) 1 1975 Kohala:AQ Candid View. Report of the Kohala Task Force(March). Kamakau,Samuel M. 1992 Ruling Chiefs of Hawaii. Originally published in 1961. (Revised Edition.) Kamehameha Schools Press, Honolulu. KeOlamagazine.com—Ke Ola Magazine website. Hawaii Island Community Magazine Kuykendall, R.and Day,A.G. 1976 Hawaii:A History from Polynesian Kingdom to American State. Prentice-Hall, Englewood. Macdonald,G.and A.Abbott 1970 Volcanoes in the Sea. University of Hawai'i Press, Honolulu.111 Moffat, R. M. and G.L. Kirkpatrick 1995 Surveying the Mahele: Mapping the Hawaiian Land Revolution. Palapala'aina. Honolulu: Editions Limited. 11 II n.a. (No Author) I 1967 Historical Notes:Waimea-Kawaihae,South Kohala, Hawaii." [On file at SHPD Library#H-463] NR n.d. Native Register of Kuleana Claims Recorded by the Board of Commissioners to Quiet Land Titles in the Hawaiian Islands. Manuscript. Hawai'i State Archives. NT n.d. Native Testimony Recorded by the Board of Commissioners to Quiet Land Titles in the Hawaiian Islands. Manuscript. Hawai'i State Archives. National Park Service, U.S. Department of the Interior website. 2018 (http://www.nps.gov) Newspaper.com—online newspapers website Oliver D. 1961 The Pacific Islands. University of Hawaii Press, Honolulu. Puakearanch.com—Puakea Ranch website ib Rosendahl, P. 1982a Archaeological Reconnaissance Survey, Puakea Bay Ranch, Lands of Puakea and Honoipu, North Kohala, Island of Hawaii (TMK:3-5-6-01:24,43,68). PHRI Report 56-060482. Prepared for Puakea Bay Ranch Partnership and Hawaii Land Management. I HAUN &ASSOCIATES 141 I I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 1982b Intensive Archaeological Survey and Test Excavations Puakea Bay Ranch Roadway Corridor, Lands of Honuipu and Puakea, North Kohala, Island of Hawaii (TMK:3-5- 6-01:24,43,68). PHRI Report 62- 070182. Prepared for Puakea Bay Ranch Partnership and Hawaii Land Management. 1984 Archaeological Field Inspection, Proposed Conservation District Residential Site, Puakea Bay Ranch Development, Land of Puakea, North Kohala, Island of Hawaii. Prepared for Puakea Bay Ranch Partnership. Sato, H.H.,W. Ikeda, R. Paeth, R.Smythe,and M.Takehiro,Jr. 1973 Soil Survey of the Island of Hawaii, State of Hawaii. U.S. Department of Agriculture, Soil Conservation Service and University of Hawaii Agricultural Experiment Station. Washington, D.C.: Government Printing Office. Schmitt, R. 1977 Historical Statistics of Hawaii. Honolulu: University of Hawaii Press. Schweitzer,S. 2003 Kohala Aina A History of North Kohala. Mutual Publishing, Honolulu. Speakman,C.E.,Jr. 1 1978 An Informal History of the Hawaiian Island. San Rafael: Pueo Press. Stephenson, L.K. I 1977 Kohala Keia (This is Kohala) Collected Expressions of a Community, A Product of Kohala People. Privately published. The Hawaiian University of Hawai'i at Manoa online library 2018 http://magis.manoa.hawaii.edu Tomonari-Tuggle, M.J. 1988 North Kohala: Perceptions of a Changing Community. A Cultural Resource Management Study. Prepared for Hawaii State Department of Land and Natural Resources — Division of State parks, Outdoor Recreation and Historic Sites. Ulukau:The Hawaiian Electronic Dictionary,A Dictionary of the Hawaiian Language(revised by Henry H. Parker). 1 2018 http://ulukau.org U.S.Climate Data website I 2018 http://www.usclimatedata.com) Waihona'Aina 2000 The Mahele Database, waihona.com. Wehewehe.org 2016 Hawai`i Electronic Library -Na Puke Wehewehe 'Olelo Hawai'i Wolfe, E.,and J. Morris 2001 Geological Map of the Island of Hawaii. U.S. Department of the Interior. U.S Geological Survey. HAUN & ASSOCIATES I 42 TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510 -0220 . APPENDIX A: LAND COMMISSION AWARDS IN PUAKEA AHUPUA'A FROM WAIHONA 'AINA) U 1 I I 1 II HAUN &ASSOCIATES 143 J TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 -022019 Claim Number: 08746 ClaimantKeawe Other claimant: Other name: Island: Hawaii District. Kohala, North Ahupuaa: Puakeaiki,Puakeanui Puuoneo,Puulaula, Kalipahale, Paehala, Haliipalala, Laleakone Apana: 7 Awarded: 0 Loi: FR: Plus. NR: 34v8 Mala Taro: FT: 77v4 Kula: NT: 121v4 House lot: 1 RP: Kihapai/Pakanu:6 Number of Royal Patents: Salt lands: Koele/Poalirna: No Wauke: Loko: No Olona- Lokoia No Noni: Fishing Rights: No Hala: Sea/Shure/Dunes: No Sweet Potatoes: Auwai/Ditch: No Irish Potatoes: Other Edifice: No Bananas. No Breadfruit: Pigpen: No Coconut: Road/Path: Yes Coffee: Burial/Graveyard: No Oranges: VVall/Fence.No Bitter Melon/Gourd: Strearn/Muliwai/River: No Sugar Cane: Pali.No Tobacco. Disease: No HAUN & ASSOCIATES I 44 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 I KoalKou Trees: Claimant Died: No Other Plants: Other Trees: Other Mammals:No Miscellaneous: 3 No.8746,Keawe,January 14, 1848 I N.R.34v8 Puakea is the Ahupua'a claim.It was from Keohokalole to Kekuanui,from Kekuanui to me,Keawe.!1 have held it/for fifteen years,that is my claim for land. I KEAWE F.T.77v4 No.8746,Keawe IKaahue sworn,testifies that claimant occupies one piece of land in Ili of Puuoneo,Ahupuaa Puakeaiki, thus bounded: I South by waste land West by waste land North by public highway East by Ili of Puulaula. I Also one lot in Ili of Puulaula,Ahupuaa aforesaid. South by land held by Kailiahi West by waste land North by waste land&public highway I East by Ahupuaa Honoipu. Also one piece in Ili of Kalepahale,same Ahupuaa. South by land held by Kauiho West by land held by KailiahiINorth&East by waste land. Also one piece in Ili of Paehala,same Ahupuaa. South by land held by Keawekipi West by land held by Paahao North&East by waste land. Also one lot in Ili of Haliipalala,same Ahupuaa. South by land held by Keawekipi I West by land held by Kupihi North& East by waste land. Also lot no.2 in Ili of Puuoneo,bounded: I South,West, North,East by waste land. All the above-descried lots consist ofdry land, partly cultivated,unfenced&no houses on premises. I Also one lot consist of one equal half of an enclosure belonging to claimant. Keohokalole,situated in Ili of Laleakone,Ahupuaa Puakeanui.Said enclosure is surrounded by public,i.e. made land belonging to Keohokalole. Kehuanui(konohiki)gave the above lands to claimant A.D 1833. I Kalamailalo. sworn,affirms as above. I N.T.121-122v4 No.8746,Keawe,October 4, 1848 Kaaua,sworn and stated. I have seen in the ili land of Puakeaiki ahupuaa.6 sections. I 1.Section I-Puuoneo Ili. Mauka by idle land Kohalawaho by idle land I HAUN & ASSOCIATES 145 I Tmx : ( a ) s o - 001 : Por . 082 Report mn . zszo uuzozy Makai by street Hamakua by Puulaula m. It has been cultivated;there is no house. 2. Section U'Puu|au|aIli. Mauka bt KaUiahi's land Kohalawaho by idle land Makai by a street and idle land Homox"abyHmno.pvahvpvop Cultivation has been done;there is no house. 3.Section III'Ka|ipaha/aIli. Maukahynaviho'vland xnho|awahohyxamuh,oland 111K0mkaiuyid|e|and Hamakua by idle land This has been cultivated; no house 4.Section IV-Paehala Ill. Mauka by Keawekipi's land Kvha|moaxouypmuxao'sland Makai by idle lend Hamakua by idle land. 0 Cultivated has been done:no house. 5. Section V HaliipalalaUi Mauka by Keawekland KohalowohnbvKvpihi'oland Makai by idle land Hamakua by idle and. A portion of it has been cultivated:no house. 6. Section VI-Puuoneo Ili land. Mauka by idle land The rest of the boundaries are Idle land Some of it have been cultivated. 7. Section VII Ill land in Laleakone ahupuaa named Puakeanul. Mauka and the rest of the boundaries are Keohokalole's land.Two houses are there,one of which is for Keawe,one for Kaaua and another house is for Keohokolole in his/Keawe?I Kekuanul had given him his interest in 1833, no one has objected. Ka}amai|a|o. sworn and stated, I have known[Left blank)[as]Kaaua has related here. pvn.a74wnot awarded] IMP GNI HAUN 8c ASSOCIATES I 46 I TMK : ( 3 ) 5 -6-001 : Por . 082 Report No . 1510 - 022019 Claim Number. 088798 Claimant:Kamalamailalo Other claimant- Kaulemamoku.father I Other name Island. Hawaii District Kohaia,North Ahupuaa•Puakea IIli. Kaawikiwiki,Puumanu,Lelckoae.Maliu Apana:4 Awarded: 1 fir Loi: FR: ill Plus NR: Mala Taro: FT: Kula: NT: 118v4 House lot: 1 RP Kihapai/Pakanu: 4 Number of Royal Patents: Salt lands: Koele/Poalima. No Wauke: Loko: No Olona: Lokoia No Noni: Fishing Rights: No Hasa: Sea/Shore/Dunes No ii Sweet Potatoes: Auwal/Ditch. No Irish Potatoes: Other Edifice:No I Bananas: SpnngANeil No Breadfruit: Pigpen No Coconut. Road/Path: No Coffee. Burial/Graveyard No I Oranges: WaIUFe No Biller Melon/Gourd: Stream/Muliwai/River No Sugar Cane: Pali No I Tobacco: Disease: No Koa/Kou Trete Claimant Died: No Other Plants: Other Trees I Other Mammals: No Miscellaneous: Awarded 1 apana,also 1028 dead claim.5 houses No.88798,Kamalamailalo F.T.107v4 Kaaua,sworn,testifies that claimant occt ies six lots of land in the Ahupuaa of Puakea,thus situated& bounded 1st lot-in Ili of Kaaikiwiki.ae South by land held by Moku West by land held by Makuahine am North by land held by Kikau East by land held by Keaulumoku. IP 2d lot in Ili of Puumanu South by land held by Kaaba Mil West&East by land held by Keauluoku North by land held by Moku. 3d lot in Ili of Lelekoae(no.1) South by land held by Moku West by land held by Kikau North by land held by Keaweopala East by land held by Makuahine. I 4th lot in Ili of Malru. South East by land held by Moku West by land hriad by Kanoena North by land held by Kaloa. I HAUN & ASSOCIATES 147 J TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 501 lot in Ili of Lelekoae(No.2) South by land held by Makaokaia West by land held by Makuahine North by land held by Moku East by land held by Kamikana. Said lots are dry land,cultivated in part,unfenced. 6th lot in Ili Lelekdae(No. 3j occupied as a house lot.It is fenced with wall. Five houses stand upon the premises,belonging to claimant&family. Title extends back to reign of Kamehameha I through parents of claimant.Uncontested. Moku,sworn,testifies as above. N.T. 118-120v4 No.8879B, Karnalamailalo,October 5, 1848 No.102B,(Dead claim) Kaaua, sworn,and stated:I have seen there are in the Puakea ahupuaa in Kohala, Hawaii. 1. Section I - Kaawikiwiki Ili. Mauka by Moku's land Kohalawaho by Makuahine's land Makai by Kikau's land Hamakua by Keaulumoku's land. This section has been cultivated and there is no house. 2. Section II-Puutnariu Mauka by Koloa's land Kohalawaho by Keaulumoku's land Makai by Moku's land Hamakua by Keaulumoku's land. It has been cultivated and there is no house. 3. Section III-Lelekoae Ili. Mauka by Moku's land Kohalawaho by Kikau's land Makai by Keaweopala's land Hamakua by Makuahine's land. It has been cultivated;there is no house. 4.Section IV-- Maliu Ili. Mauka by Moku's land Kohalawaho by Kanoena's land Makai by Kaloa's land Hamakua by Moku's land. It has been cultivated;there is no house. The house-lot section is in the ili land of Leleakoae. It has a fence and there are 5 houses, 3 of which are for him/Kalamailalo/and 2 for Kaulernamoku,who is his father. This had been acquired by his parents during the time of Kamehameha I;no one has objected. Moku,sworn and stated.I have known[Left blank][as]Kaana has related here. Award 8879B;Leleakoae Puakea nui N.Kohala; 1 ap.;4.3 Acs;No. 102B not awarded] I HAUN & ASSOCIATES I 48 TMK : ( 3 ) 5 -6-001 : Por . 082 Report No . 1510-022019 APPENDIX B: NRHP NOMINATION FORM r I I I I I I 1 I I I I I HAUN &ASSOCIATES 149 I TMK : ( 3 ) 5 - 6 -001 : Por . 082 Report No . 1510 - 022019 I pips Form 10-930 OW No,1024-0015 EXPIMSitf20i 2i United States Department of the Interior National Register of Historic Places Registration Form I ri-, tz, ,,ii!.,use in ri;:rmiriadIrly Or requesting determinations to.individual properties and dialled. Sm instrucdons In WOW Register duke),How o Compiere me National Reviver of Halo*Pisces Roglalfalan Fonn. If any Ilam dose not apply to 1*property bairc doomminkid,enter TWA'lor r.o? applicable' For lunchons architectural etas:elutionmimosa.and MINI of sigralcanoe.enter Only oelegoriee and gubernatorial'from Ito Instruct.ons Place additional certification comments,entries,and AS News onaondramtkm shaft Ifneeded(NP$Form 104110e). 1. Name of Property historic name Puakea Ranch other names/site number James Wright Estate/Puakea Plantation/Puakea Ranch of Kukupahu I 2. Location street 8.number 56-2864 Akoni Pule Highway not for publication city or town Hawi F.vicinity state Hawaii code HI county Hawaii code 01 96719 3.State/Federal Agency Certification I As the designated authority under the National Historic Preservation Act,as amended, I hereby certify that this nomination request for determination of eligibility meets the documentation standards for registering properties in the National Register of Historic Places and meets the procedural and professional requirements Isetforthin36CFRPan60, In my opinion,the property meets does riot meet the National Register Crieria: I recommend that this properly be considered signrticant at the following level(s)of significance: nat7naI statewide _local I Signaturel4tifying official Dale A-115 4"-- 944— Ttner26../ 4 ' 7 Stale an Raked agencytbureau n Topa,Governreant I In my opinion,the property meets does not meet the National Register criteria. with.s of commenting°Mow Date I Tido State or Federal agencytureau or Tribal GOVellenent 4. National Park Service Certification I.hereby,misty net see property is. eneered In the Nuke*Register caMmiminad MAN kw the ketone'Register I delanained nal engine for the National Register removed front 1wNesonet Register altar(wrabinr) I Signature al the Keeper Date of Action 1 1 1 I HAUN & ASSOCIATES I 50 TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510-022019 Puakea Ranch Hawaii,Hawaii Name of Property Countyand Stale 6. passMwtion Ownership of Property Category of Property Number of Resources within Property Checkas many bons as apply) (Check oray are box) Do not include previously feted resources In the count) Contributing Noncontributing X private building(s) 6 0 buildings public-Local X district district pubic State site 6 0 site pubic-Federal structure structure abide obisot 12 0 Total Name of'dated multpb property listing Number of contributing resources previously Enter"NIA"if property isnot pert of a multiple property Mang) tested in the National Register N/A N/A 6.Function or Use Historic Fundlons Current Functions Erser categories from rustrucslw») Enter aleporfes from instructions) See Continuation Sheet) See Continuation Sheet) i 7.Description Architectural Classification Materiels Furter categories from Instructions) Enter categoriesfrom instructions) Lava rock w/wooden posts. Other—Vernacular plantation style foundation: Concrete slab Wood/single wall,tongue and groove wais: board and batten,wood shingles roof: Metal corrugated steel other I I HAUN &ASSOCIATES 151 I ell TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 1 viP i:Flirt 01/2009) OMB No.1024-0011 Elwin 51126121 1 United States Department of the Interior ell National Park Service National Register of Historic Places Continuation Sheet PUIIIMS RWX7h KM*,HMO WA I Salon number 6 PON 2 lesionc Functions. Balm NtsritrerCi‘ I :Cet 1. DOMESTIC Su). Single Derseing(Ranch House) 2. DOMESTIC Single Dwelling(Oorboy House) 9. DOMESTIC Single ng(Cambay House) 4. DOMESTIC institueorei Hawing(Bunk House) 5. DOMESTIC instituter*Housing(Bunk House) S. AGRICULTURUSUSSISTANCE Agricultural Oulbulking(Sunk rooms/Tool and supply s11.01 I i 7 AGRICULTURE/SUBSISTANCE AgrioulselOulbulding(Estegs) Et AGRICULTURE/SUBSISTANCE Processing(SsughlsrHouse) 9 AGRICULTURESUBSI STANCE Processing(SupsM111)IIS. AGRICULTURE/SUBSISTANCE Agricultural Reid(Dry Mid isys rook veils) 11 AGRICULTURE/SUBSISTANCE Amnia]Facility(Fenced inlaid coed) 12 AGRICULTURE/SUBSISTANCE Storage Melds leper/stomp shed) I Omens Functions: 14~1 ICatI, DOMESTIC Single Dieser*(Ranch Mouse) 2. DOMESTIC single Duo%(Ranch Ham) a DOMESTIC Single Orrellng(fence Howe)I4. DOMESTIC Singls Deed%(Renck House) S. DOMESTIC Single Deming(Ranch House) 8. AGRICULTURE/SUBSISTANCE Agriculture Oulbuikkng(Bunk Rooms/Tool end apply stud) 7. AGRICULTUREJSUBSISTANCE Agriculture Oullarldtrig(Garage) 8 AGRICULTUREJSUBSISTANCE Processing(illsughtet House) 9. AGRICULTURE(SUSSISTANCE Vocal(Sugar Mill toundaaoe and ch)mnay)i I 10. AoRicaTuRusuasisTANcE A9ricounti Field(pry laid lava rock watt) 11. AGRICULTURE/SUBSISTANCE Animal Facility(Fenced animal corral) 12. AORICULTURE/SUBSJSTANCE Storage iSaddle repair I storage shed)i 1 I I HAUN &ASSOCIATES I 52 TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510 -022019 Puakea Ranch Hawaii,Hawaii Name of Property County and State r INarrative Description Describe the historic and current physical appearance of the property. Explain contributing and noncontributing resources if necessary.Begin with a summary paragraph that briefly describes the general characteristics of the property,Such as I its location.setting,size,and significant features.) Summary Paragraph The property lies along the mauka(mountain)side of Akoni Pule Highway on 33 acres The land is enclosed by dry laid lava rock walls and has the remains of earlier generations of agricultural and ranching activities upon rt Of the ruins,the most prominent is a small sugar mill chimney in the back of the property Several house and traditional Japanese bath foundations are spread across the landscape. Still fully existent are five traditional homes,a slaughter house,fenced cow corral,and a saddle repair,'storage shed that testify to the change from sugar production to cattle ranching in the area. I The five homes represent examples of local vernacular architecture.are constructed of wood on posts and piers,with hipped metal roofs. Two of the structures were modified from bunk houses into single family use. I r I Narrative Description I See Continuation Sheet) I I I I I I HAUN &ASSOCIATES 153 I TMK : ( 3 ) 5 - 6- 001 : Por . 082 Report No . 1510 - 022019 NPS Form NYGICCI. Mery Ob2000I 04w w 1024-00'P rFm es r-i'2012) United States Department of the Interior National Park Service National Register of Historic Places Continuation Sheet Puakea Ranch Naw.Hawaii N/A Section number 7 Papa 2 Architectural Descriptions Building$5: Located upon the northwestern side of a gravel road used to enter the Ranch is(Building 5). Old time residents remember that this structure was existent in 1922 County lax records first documented it in 1929 Parker Ranch records record the structure as$253. The structure is an old single man's Paniolo(cowboy)style dwelling consisting of a simple 5/12 inch A frame with board and batten siding and wood shingles on the exterior of the bath room and the north and east facing exterior walls. The roof Is supported by 2 X 12 rafters with 42 inch centers with visible tails. The entry is by four steps centered on a deckrlanai. The entry gives passage to the Irving area with double six-pane slider windows on the makai(ocean)side. The living area includes a kitchen located to the north east rear with a double six paned horizontal slider window located above the sink and counter top. The makai side of the kitchen has a back entry porch that leads to an outside bathroom located to the north. To the east of the kitchen,mauka,is the 20 foot by 16 foot bedroom. The bedroom has three windows-one each on the north,east,and south walls. The interior walls are genuine paniolo style with vertical 14 inch by 2 foot batten with 12 foot on center throughout. Vertical battens are interrupted by horizontal 2 by 3 foot chair rails. The walls extend down to meet simple 1 inch by 4 inch baseboards. The floors are typical 1 inch by 6 inch tongue and groove Douglas Fir. The back(north facing exit)steps down three levels to a large lava rock landing that leads to the original Japanese style bathhouse Euro. The concrete bathhouse foundation is approximately 12 by 8 Behind the bathhouse to the north is a large concrete cistern aproximately 16 by 5 feet. This currently is filled with dirt,although the walls are still visible. Building#4 Oral histories also declare this structure existent in 1922,while country tax records show 1929. Parker Ranch records list 1/ this as Building$270. Located to the south of(Building 5),this is a typical Paniolo Bunk style house with a porch/lanai extending the length of the facade. The main entry contains four steps leading directly to a lour panel entry door. Three more entries are accessable from the porch,each leading to two or more bedroomsrbunkrooms and the bathroom on the north west end of the building. The house is seperated into these lour areas,entered by four doors,in order to provide privacy to the paniolo families.The number of panels on the exterior doors varies from 2.4,and 5.reflecting the evolution of the house, Nei The porch is unique to the paniolo history of the Kohala district because is consists of three horizontal rails defining the porch with 4 by 4 posts that are 10 feet on center. It is clear that the constant winds of Kohala encouraged the construction of eaves braced to the support posts. mei The finish colors traditional of the area--green siding,white trim,and red corrugated metal roof.The front facade has 4, 6 over 6 double hung windows The single walls consist of board and batten spaced 12 inch on center with!z inch by 3 inch batten. nr HAUN &ASSOCIATES 154 1 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 NPS Form^` les' 0,:?(709C)MF No 0 4;X' Eei. s 5.31?C12; United States Department of the Interior National Park Service National Register of Historic Places Continuation Sheet Puakea Ranch Haw,Raab N/A Section number 7 Page 3 The foundation is post and pier located on lava rocks. The roof is typical 5/12 pitch with an additional 3/12 extending over the porch/lanai. Inside the house,the main entryway leads to the living room. The interior walls are genuine paniolo style with vertical lit inch by 2 foot batten with 12 loot on center throughout. Vertical battens are interrupted by honzontaai 2 foot by 3 foot chairrailthroughout. The walls extend down to meet simple 1 by four baseboards. The floors are made up of typical one by six inch Douglas Fir Located to the right of the living room is a bedroom with two.6 over 6 double hung windows Passing through the living room one enters the kitchen and dining area. There is a horizontal window above the sink and counter area. To the west is an exit door to a covered landing with three steps down to a concrete pathway that leads to a smoke house and wash house in back of the home. (The dimensions of the smokehouse and wash house are-•--). Building No.3 This building is noted in country tax records from 1929. It is also referred to as Parker Ranch Building No.273. The building is a typical paniolo style structure consisting of two single man bunkrooms entered through two exterior doors. side by side. Each bunk rooms approximately 10 feel by 12 feet.with a single 2 over 2 double hung window adjacent to the entry door.The front elevation laces northwest and looks out to Maui. The front facade consists of a combination of board and batten 12 toot on center and 1 by six vertical tongue and grove siding. The north end wall also has a 2 over 2 double hung window. Connected to the bunk rooms to the south is a covered.3 bay area defined by 4 by 4 posts 1 supporting the front approximately 12 feet by 36 feet. The foundations post and pier located on lava rocks. Finish color for the structure is traditional,with green siding,white trim,and a corrugated metal roof. Building No.2 This building is first noted on county tax records in 1940. The Parker Ranch structure inventory called this Building 253. Oral histories suggest the home was moved to the present site from Mahukona,perhaps explaing why the building has more of a Plantation rather than a Paniolo style of architecture. The dwelling is located on the southern part of the property,adjacent to the Slaughter House and the remains of an earlier ranch building The front entry facade faces the ocean and is defined by its central entry steps. The 12 by 20 deck is an addition.and extends the length of the front facade. The entry door contains 12 panes Of glass and a lower panel single door flanked by double sets of double hung 6 over 6 windows. The facade elements clearly are defined by a 1 x 6 inch white vertical and horizontal trim. The exterior single walls are covered in a triditional green stained wood shingle. The corrgated metal sheeting roof is centered over the entry with 5..12 pitch.The deck and railing have been altered over time but still consist of the basic 4 x 4`crossed bracing. The wood shingles extend throughout the exterior of the house. The front door opens into a 12 by 16 foot living room with natural 1 x 6'Douglas Fir flooring throughout. All interior single walls in the house are 1 by 6 in tongue and groove boards wdh decorative moldings. A horizontal chair rail throughout HAUN & ASSOCIATES I 55 3 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 3 United States Department of the Interior National Park Service3 National Register of Historic Places Continuation Sheet Puska'Ranch Hawl,Hasid NiA Secuon nun-q) , ' Page 4 I interrupts the walls. There are 3 windows in the living area,of which all are 6 pane with sills lovered to 2 feel above the 111 floor. The baseboards are simpe 1 by 6 inches throughout. Ceilings are uinversally 9 feet.irs Next to the master bedroom a second bedroom shares many of the same characteristics, Only the windows are different. being 2,6 pane with sills lowered to 2 feet above the floor. One window is located on the north wall,while the other is ontheeastwall. The living room and kitchen are separated by a half wall and counter top on the kitchen side. The real wall of the kitchen contains a single French door and a pair of 6 over 6 pane windows with sills lowered to 2 feet above the floor. Exiting the rear kitchen door,one steps onto a rear porch extending the length of the building with deck steps leading to the outdoor bath house located to the east. The bath house consists of the same green stained wood shingle and white trim as the house,with a 6 pane,horizontal hinged window facing west,next to the 5 panel door leading inside. The roof is a lean-to. Inside.remnants of the original Japanese turo can still be seen. The east-facing wall consists of 2,2 paned horizontal sliding windows. On the southern most boundary is the Slaughter House,Olt Slaughter House The slaughter room is approximately 14 by 16 feet in size, The cattle entry is 8 feet wide. There is a 8 foot engry on both sides of the building,mauka and makai. On the southwest end of the building is a 4 foot entryway to where records of the slaughter were recorded and filed. To the southwest wall of the office area is a third opening approximately 3 feet wide where the intestines were discarded into a wheel barrow to be cooked close by in a wrought iron glubber post and fed to the pigs in the nearby corrals. The roof of the structure,which no longer exists,extended over 15 feel where a ridge beam of 4 by 10 foot diameter supported ropes that hoisted cattle for processing. On the northwest side of the slaughterhouse is a concrete bunker trough extending 15 feet into the cround where the fluids were gided away from the building after the slaughter. To the southwest of the Slaughter House are the remnants of a house,which consisted of a 10 by 20 foot building with a lean-to roof. Here the hides were laid flat and salted with Hawaiian rock salt for curing. Once the hides ere cured,the salt was saved for reuse. The hides were then folded and rolled to be sold elsewhere. Building No.1 County tax records first note this building in 1951. Oral histories suggest that this house was build out of materials 3 salvaged from the original home of James Wight Parker Ranch recoreds list this as Building 0267. The exterior façade elements are clearly defined by a 1 by 6 inch white vertical and horizontal trim. The exterior single walls are covered with traditional green stained wood shingles. The corrugated metal sheeting roof extends over the entryway. The deck and railing have been altered over time but stall represent the historic integrity and architectural ambiance of the home. Atter ascending 8 steps and crossing a covered porch area,the houses entered through a set of double French doors equipped with double screens. Atter passing through the foyer.the kitchen is to the right and the dining and living area to r the left. The living room faces the northwest with views out the French doors to views of Maui. To the right of the livingroomiswhatappearstohavebeenathirdbedroombutwhichisnowpartofthelivingroom. The 6 windows throughout the living and dining area are all 2 over 2 double hung with low sills extending 20 inches from the floor. The floor ra HAUN & ASSOCIATES 156 I TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510 - 022019 I United States Department of the Interior INational Park Service National Register of Historic Places Continuation Sheet I I throughout the home is clear 1 by 6 inch tongue and groove Douglas Fir The floorboards are oil by 8 inch butted design to catch a 1/6 inch moused trim. The single walls are typical wainscot Douglas Fir interrupted by a chair rail that extends throughout the house The ceiling is also comprised of 1 by 6 inch tongue and groove boards with decorative moldings. I To the east of the living room are tow bedrooms entered through a small hallway that connects the rooms with a bathroom between them. The interior bedroom and bath doors are all 5 panels.plantation style. The eastern most bedroom is also accessible through a read deck leading toward the old Sugar Mill site The windows in both bedrooms are 2 over 2 double hung with low sills extending 20 inches from the floor 1 I I I I I I I INPS Form 1069O0-. IRes,01 20001 OMB No.IQ4-0.0 m B iE4.s 5i31r20121 I I HAUN & ASSOCIATES I 57 tie TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Puakea Ranch Hawaii,Hawaii Nameof Property County and State B.Statement of Significance Applicable National Register Criteria Areas of Significance Mark'1in one or more bores for the cnlena qualifying the property Enter'categorise from Irelruolion' fur National Register listing) Agricultural-Ranch and sugar plantations Social history James Wright and Parker RanchAPropertyisassociatedwitheventsthathavemadea A , significant contribution to the broad patterns of our history Architecture- vernacular ranch styleF1 B Property is associated with the lives of personstXsignificantinourpast we C Property embodies the distinctive characteristicsXolatype,period,co method of construction or represents the work of a master,or possesses high Period of Significance artistic values,or represents a significant and distinguishable entity whose components lack 1848-1951 individual distinction, x D Property has yiaided,or is likely to yield,information Imo important in prehistory or history,Significant Dates See continuation sheet 1=1 Criteria Considerations Mark eq the boxes that apply)Significant Person Properly is: iCompieie onry it Crrterwar+13 maiked afx)re James Wrightowedbyareligiousinstitutionorusedforreligious A purposes, B removed from its original location Cultural Affiliation Multi-ethnic Hawaii sugar and ranching community C a birthplace or grave I 1 D a cemetery E a reconstructed building, oArchltect/ Buliderbiect,or structure. Unknown F a commemorative property. G lessthen 50 yews and or achieving significance within thepest 50 yews. Period of Significance(justification) 111 Criteria Consideratons(explanation,if necessary) NIP VIP HAUN & ASSOCIATES I 5 8 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Puakea Ranch Hawaii.Hawaii Name of Property County and State Statement of Significance Summary Paragraph(provide a summary paragraph that includes level of stgnflcance and applicable criteria) The site of Puakea Ranch has been occupied through four eras of Hawaiian economic history. The land was first employed for Native Hawaiian agriculture. The second use occurred after contact with Europeans,as a sugar plantation was developed by private entrepreneurs such as James Wright.using imported water and multicultural labor. A third era focused on the cattle ranching Most recently,buildings on the site have been reused as"bed and breakfast' operations of the tourist trade Narrative Statement of Significance (provide at least one paragraph for each area of significance) ISee continuation sheet) 111 Developmental history/additional historic context information of appropriate) 1 I 1 I HAUN & ASSOCIATES 159 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Irk United States Department of the Interior aidNationalParkService National Register of Historic Places Continuation Sheet Puakea Ranch Haw1,frau: 3WA Secuan number 8 Page 2 I The site of Puakea Ranch has been occupied through four eras of Hawaiian history, The land was first employed for Native Hawaiian agriculture, The second use occurred after contact with Europeans.as a sugar plantation was developed by private entrepreneurs such as James Wright,using imported water and multicultural labor. A third era focused on the cattle ranching. Most recently,buildings on the site have been reused as-bed and breakfast' operations of the tourist3trade. Criteria A: Puakea is located within part of the Kohala Field System,a series of rock and earthworks built by Native Hawaiians in pre•wisiocontacttimesthatdirectedwaterflowandterracedtheland,while making maximum use of rainfall and preventing soil erosion. The success of this system in sustaining a large population is evidenced by the construction of two hieau.or temples,at Kukuipahu and Mookini Laukini nearby. The extensive agricultural system,like the North Kona Field System to the south,are only partially mapped. All 33 acres of Puakea Ranch Ise are surrounded by ancient dry stack rock walls.beside a stone corral located inside. wit Beginning in 1848,King Kamehameha III a series of laws,later known as the'Great Mahele",that sanctioned the subdivision of the island into private.tee simple ownership. Initially Puakea was held in private by the monarch,as crown 9ff lands,until Dr.James Wight purchased the land in 1870 from King Kamehameha I's grandaughter Kekauonohi. Production of sugar was then attempted at Puakea. Dr.Wight built an animal powered mill at Puakea to process sugar. The Kohala Ditch was also constructed to provide the large amounts of water necessary.with the water system servicing several plantations before reaching the last reservoir at Puakea, Unfortunately water flow was never satisfactory,and the last sugar crop was milled in 1930. A typical plantation camp had grown up around the struggling mill,however,and when Dr.Wight established his ranch operations at Puakea.the focus of the settlement changed to accommodate that industry Cattle had originally been introduced to the island of Hawaii in 1793 by British Captain George Vancouver. King 3 Kamehameha initially placed a"kapu"(law)against killing the animals,and the bovine population soared until population controls became necessary. Vaqueros,of mostly Mexican.Indian,and Spanish descent, immigrated to Hawaii to teach Native Hawaiians and others such skills as cattle handling techniques and leather working. The term Espaniolo became 1 reworked into the Hawaiian lexicon as`Paniolo". Hawaii's contribution to cowboy legend was made by Kohala born paniolo lkua Purdy in 1908,when he won the wold rodeo steer-roping championship, Generations of Japanese.Caucasion("haole").and mixed blood paniolos worked Puakea and other cattle operations for over lour generations. In the meantime.cattle operations centralized. In 1944 Puakea Ranch was purchased by Richard3SmartasanadditiontohislegendaryParkerRanch,at one time the largest cattle ranch in the world. In 2002 Parker Ranch sold 200 acres at Puakea to a local developer who subdivided the land. The subdivision boundaries followed the many historic rock walls in the area. Sadly, large scale cattle ranching was discontinued,and many of the historic paniolo families moved out. 3 Most recently,most of the existing structures on the 33 acre Puakea Ranch focus property have been renovated and are now reused as overnight accommodations for tourists. Criteria B:s n rr HAUN & ASSOCIATES 160 I ITMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Puakea Ranch Hawaii,Hawaii IIName 0 Property County arKI State Name of Property: Puakea Ranch ICity or Vicinity:Hawi County:Hawaii State: Hawaii IPhotographer: Tax Map Date Photographed: 2009 IDescription of Photograph(s)and number: Relationships of buildings and major ruins on Puakea Ranch. 2 of 19. I I T1 lenbi * is4 , rili I 0 Ili1....4 VA 1 i I i 1$1 r 1 i \ 1 1 1 1 1 I A i 1, 1 1..t..kiky.. V I V ..1.* i - A, i 0-, 1 i t 4 I II ilIli iIllti 1 ir. kl,I 1 11 1 li k 1 I I I I 111 HAUN & ASSOCIATES I 67 I TMK : ( 3 ) 5 - 6-001 : Por . 082 R , pc - ', No , 1510-0220 19 I P,,ap,ea Ranch H18.1111.Hawaii Provertv Canty and Male Name of Property: Puakea Ranch City or Vicinity:Hawi iCounty: Hawaii State: Hawaii Photographer: Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Map of Puakea Ranch showing stone walls in relation to property lines,buildings,and roads.I/ 3 of 19. I 0 III , .0 E:':•', I 61 ; A I F.; I TTs. 1) o'. . , 111 . o e:II 8 I ii1 Irr.e..:1141tlied: 4 , 111.:'. . cx i 0., • ft:.....:----..-., he 41,4StA4/41;66,--- ----j C.) a 0 CZ I , HAUN & ASSOCIATES I 68 1 TMK : ( 3 ) 5-6-001 : Por . 082 Report No . 1510 -022019 Puakea Ranch Haw*Hawaii 1 Name of Property CountyandStab Name of Property. Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii 1 Photographer: Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Row of Java Plumb trees planted in the late 1870s 1 4of19. i 1 i 1 1 1 1 1 1 1 HAUN &ASSOCIATES 169 TMK : ( 3 ) 5- 6-001 : Por . 082 Report No . 1510-022019 Puska*Ranch Hawait,HawaiiNeneotPropettyCotstyandState Name of Property: Puakea Ranch City or Vicinity:Hawi County• Hawaii State: Hawaii Photographer: Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Old Sugar Mill stack before it fell in earthquake. 5 of 19. 4", Ir . 13 1 HAUN & ASSOCIATES I 70 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 -022019 Puakea Ranch Hawaii,Hawaii Name of Property County and State Name of Property: Puakea Ranch City or Vicinity:Ham Hawaii State Hawaii Photographer: Tax Map Date Photographed: 2009 Description of Photograph(s)and number: 1870 brick in Mill stack rubble. 6of19. 2 .. . 4,311 1 I 14 HAUN & ASSOCIATES 171 1•0 TMK : ( 3 ) 5 - 6 - 001 p 0 r • 0 8 2 Report No . 1510 - 022019 met Puakea Ranch iia7ntyandStatealLHawait Name of Property Cci Name of Property: Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii Photographer Tax Map eirDatePhotographed2009 Old Sugar Mill site looking southwest. a: Description of Photograph(s)and number: 7 of 19 10 I HAUN & ASSOCIATES I 72 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 Puakea Rance Hawaii,Hawaii Name ofProperu County and State Name of Property: Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii Photographer Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Vintage cow corral from the 1940s. 8 0119 1 1 1 HAUN & ASSOCIATES 173 TMK : ( 3 ) 5 - 6-001 : Por . 0 8 2 Report No . 1510 - 0220 19 111 Padilla Ranch Hawaii,Hawaii Nomeof Prope(1y County and State Name of Property: Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii Photographer Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Building Number 5 showing shingles on wall 9 of 19. I 774 HAUN & ASSOCIATES ! 74 1 I TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510 - 022019 Puakea Ranch Hawaii,HawaiiNameOfcrock.. Countyand State Name of Property: Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii Photographer. Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Building Number 5 showing different wall construction on opposite wall. 10 of 19. 1 1 HAUN & ASSOCIATES 75 TMK : ( 3 ) 5 - 6 -001 : Por . 082 Report No . 1510-022019 Puakea Ranch Hawaii,Hawaii Name of Property County and State Name of Property: Puakea Ranch City or Vicinity:Hawi County: Hawaii State, Hawaii eat Photographer Tax Map Date Photographed: 2009 Description of Photograph(s)and number. Building Number 4. 12 of 19 r *}'` Li "Li I 19 HAUN & ASSOCIATES I 76 U TMK : ( 3 ) 5 - 6-001 : Por . 082 Report No . 1510-022019 Pude RanchHawaii,Hawaii Name ofProperty County and State Name of Property Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii Photographer: Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Building Number 4 from the left side. 13 of 19. Sr I 1 I I I I I U HAUN & ASSOCIATES 177 5 - - 3 1 9 r C 2 E ts4 C 1 5 1 - 2 2 3 9 karc' Name of Property Puakea Ranch City or Vicinity:Hawi County: Hawaii State. Hawaii PhotographerTax Map Date Photographed. 2009 Description of Photograph(s)and number: Exterior of furo(Japanese style-bath house)adjacent to Building 4. 14 of 19. 4 kir HAUN & ASSOCIATES I 78 TMK : ( 3 ) 5 - 6 -001 : Por . 082 Report No . 1510 - 022019 Radium Rands Hawaii,Hawaii Name or Property County and State Name of Property: Puakea Ranch City or Vicinity:Hawk County: Hawaii State- Hawaii Photographer: Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Building No.2. 15(>119 v, ' t.- ;4). A 1` ice. 4"V* . r yA YR Alirrum.` ow Y F^''% 1 I t 22 HAUN & ASSOCIATES 179 JMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Hawaii,Hawaii County and State Name of Property: Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii Photographer:Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Interior.Building No.2. 16 of 19. HAUN & ASSOCIATES I 80 1 TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510-022019 Puakea Ranch Hawaii,Hawaii 1 Name o4 Prows, County and State Name of Property: Puakea Ranch 1 City or Vicinity:Hawi County: Hawaii State Hawaii Photographer Tax Map Date Photographed: 2009 Description of Photograph(s)and number: Original bathtub. Building 1. 17 of 19. i i i 1 1 1 1 1 1 24 1 1 1 HAUN & ASSOCIATES 181 TMK : ( 3 ) 5-6-001 : Por . 082 Report No . 1510 - 022019 I Puska,Ranch Hawaii,Hawaii Named Property County and State I Name of Property: Puakea Ranch City or Vicinity:Haw;1 County: Hawaii State: Hawaii Photographer. Tax Map 41 Date Photographed: 2009 Description of Photograph(s)and number. Living room.building No.1. 18 of 19. I i ii, kijt L It it ilMli I I I I I I I 25 1 I I HAUN & ASSOCIATES I 82 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Dr.James Wight was born in India in 1814 of Scottish-Irish parentage and received his medical education at the University of Edinburgh in 1836 After practicing medicine for 13 years in Australia.the California gold rush encouraged him to leave for the United States with his family. His plans for immigration to American were thwarted,however,when his ship was wrecked off Mahukona. As doctors were scarce in Hawaii,he was persuaded to remain and opened a store/drug store in Kobela. Wright eventually sold the store to Samuel G Wilder,another entrepreneur who later built a railway from Manukona to Kohala Wight in 1852 became a Circuit Judge and served until 1863. Interested in politics,he was initially elected to the House of Representatives and later the House of Nobles under the Monarchy. Meanwhile,he had become interested in the cultivation of sugar cane.,purchased a large interest in the Kohala Plantation,and established another plantation at Halawa. He also engaged in cattle ranching,establishing his operations at Puakea. In 1879 he was elected president of an association of planters and mill owners representing the Kohala area. During the era of the Republic of Hawaii,Dr. Wight was reported to have opposed the government's plans for annexation. He died on September 2, 1905 at the age of 91 Criteria C: Puakea Ranch represents examples of Native Hawaiian,plantation.paniolo.and ethnic architecture and economies. 1 As part of the North Kohala Field System,the walls demonstrate an understanding of climate.hydraulics,and horticulture by the first ethnic group the Native Hawaiians. The initial area wall organization reflected the need to direct moisture collected on the upper slopes of the mountain store and store it at lower elevations experiencing more sunlight and less rainfall. The dryland stack walls that organize the property itself represent a method of construction involving great amounts of physical labor that would be difficult to replicate or finance today Building No.3 represents features of a Plantation style of architecture rather than paniolo style because_ The existing different types of housing on the premesis reflect the social hierarchy of the ranch period. Single family houses would have been occupied by management while bunkhouses(early examples of duplex or quadplexes)were lived in by manual laborers Limits to space,privacy and ammernties would thus illustrate social station and occupation. The strong Japanese influence at this site in the ranch era is reflected in the number of traditional Japanese furo(bath) buildings.Japanese bathing,unlike western practice,involves washing oneself off first outside the bathing basin and then soaking in heated water for a period of time Thus the structures contain separate areas for the initial cleaning and then the soaking practices. The recent upgrading of the paniolo structures reflects a mix of historic integrity and new amenities that the owners feel is necessary to attract tourists to stay overnight Integrity is maintained by the use of mostly older materials,retention of the lot layout and open space.and non-disturbance of archaeological resources. Criteria D_ As an active site during tour distinct periods of occupation,the site holds archaeological potential. Photographs and an enclosed map illustrate this potential As of this date.no detailed archaeological study has been done. Nomination to the Registers would encourage preservation of the site until funds become available. United States Department of the Interior National Park Service ONO HAUN & ASSOCIATES 161 I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 I Puakea Ranch Hawaii,Hawaii Name of Properly County and State Photographs: Submit clear and descriptive black and white photographs The size of each image must be 1600x1200 pixels at 300 opt pixels per inch)or larger Key all photographs to the sketch map 3 Name of Property: Puakea Ranch City or Vicinity:Hawi County: Hawaii State: Hawaii 1 PhotographerTax Map Date Photographed: 2009 Description of Photograph(s)and number' Puakea Ranch in relation to other Kohala properties. ei* 1 of 19. OW t. ,4 k::I i...' imi.... II 1rig./ Ilk iii°71.1 ASA ase. 1114 0'.. y.OP 1-„ 4...(.074j. / Hi ii, .:.1,0,,,.. I 4 0ifflit, 'W. 1 •'"*.' '-'411.11 ..Y.41.46. ...W. tallift. '.t 9111 i / Ilea 74, reel& I s I fl . ama 0011111 A 1 410 rt. Air 1' x-,A. ,i-- 0.1,-,,,.. •, ,....,ew."`"”; ,„#,,,,,:....'''' ''':' ' 4'.. ,*,•' 0600 ..*"' I, , .,. ,,.' '.,-•"°"5„....-' ,,,.'....- m r I Ailre--``'' - wo 40 i.A. V.,...*4.,,- 4 TMK',.(3)5--b-c>c r:oet2. I , I I ' I do I III HAUN & ASSOCIATES I 66 I I TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 Putflcea Ranch Hawaii,Hawaii I NameetP County and Stale Name of Property: Puakea Ranch City or Vicinity.Hawi I County: Hawaii State: Hawaii Photographer: Tax Map IDate Photographed: 2009 Description of Photograph(s)and number: Lanai and view.Building No. 1 I 19 of 19. I 1 111 I I IPepeneo k Reduction Ad Statement: This information btxeem`g coppUed for vocations to the Stational Register at Historic Places to nanrtatepropertiesterlistingordetermineeligibilityforlisting,to Na properties,and toamend existing Nsurrps. Response to this request is required to obtain abenefitinatcordenoenththeNationalHistoricPreeaWionActasamended(18 U.S.C.480 et eeq.).btillnMd taWan Stolle teat Pubic reportingburden forthis form is estimated to average 18 hours per response including time for reviewinginstructions,gdurig and maintaining data.andcompleting and reviewing theform. Direct comments regarding this burden estimate or any aspect orthislartotheCubeatRimingandPerformanceManagement.U.S.Dept to the interior,1849 C.Street,NW. Wastingion.DC I I I 26 I I I HAUN &ASSOCIATES 183 1 Ii TMK : ( 3 ) 5 - 6 - 001 : Por . 082 Report No . 1510 - 022019 I I, Mariamoku Hanalei,Hawaii Name of Properly Count and Stale I,I 1 I Paponwork Reduction Act 11110ment: This informatszin is balm collected for apploarions to Sas Nsticrial Aegis*or Historic Plass lonominate prowls'torkaporollsnoinsMobility ix list%to lel popsies.and to mind Waling Wings. NospcsestoIts request Is requiredtochain s NMI insocardertos viah Ilis NmIons1 Mow Pnosimmion Mt asantenctid(10 U.S.C.400 M seq.). Estimated Burden Si ... Pubic reporting burden for MI loon is ostrostod to moo ISSows pot respireinckcsno lime lot revising instructionsgathenng and maintaining data.and completing and reviewing the Conn Direct comensris nopollog Ihis burden somata orsirs wed althisformtotheOftreofPlanningandPeriorrnanceManagementUSDepttotheInterior.WOG.MO.NW.Woohloptio.DC I I I I I I I I I I I8 I I HAUN &ASSOCIATES I 84 el I 1 SPECIAL PERMIT PUAKEA GUEST RANCH 1 1 TMK: (3rd) 5-6-001:082 Puakea, North Kohala District, Hawaii Island, State of Hawai`i 1 Appendix 3 Cultural Impact Assessment 1 1 1 1 1 1 1 i Report 1516-011819 CULTURAL IMPACT ASSESSMENT PUAKEA RANCH PUAKEA AHUPUA'A NORTH KOHALA DISTRICT, ISLAND OF HAWAI'I TMK: (3) 5-6-001:POR. 082 1 I HAUN & ASSOCIATES ARCHAEOLOGICAL, CULTURAL, AND HISTORICAL RESOURCE MANAGEMENT SERVICES 73-4161 KAAO ROAD, KAILUA-KONA HI 96740 PHONE: 808-325-2402 FAX: 808-325-1520 Report 1516-011819 CULTURAL IMPACT ASSESSMENT PUAKEA RANCH PUAKEA AHUPUA'A NORTH KOHALA DISTRICT ISLAND OF HAWAII TMK: (3) 5-6-001:POR. 082 By: Haun & Associates Prepared for: Christie Cash, Puakea Ranch 56-2864 Akoni Pule Highway Hawi, Hawaii 96719 January 2019 HAUN & ASSOCIATES ARCHAEOLOGICAL, CULTURAL,AND HISTORICAL RESOURCE MANAGEMENT SERVICES 73-4161 KAAo ROAD, KAILUA-KONA HI 96740 PHONE: 808-325-2402 FAx: 808-325-1520 I NNW TMK: (3) 5-6-001: Por. 082 Report 1516-011819 SUMMARY At the request of Christie Cash, Haun &Associates conducted a cultural impact assessment(CIA) of a 14.92 acre portion of TMK: (3) 5-6-001:082; a 32.411 acre parcel in Puakea Ahupua'a, North Kohala District, Island of Hawai'i. The objective of the assessment is to identify any culturally significant resources or traditional cultural practices that occurred within the project area and its immediate vicinity. The assessment relies upon archival research focused on historical documents, previous archaeology studies, previous cultural impact assessment reports, and oral interviews. This assessment addresses potential cultural impacts that future development could have on any traditional cultural practices or resources following the framework set forth by the Hawai'i Supreme Court in the case of Ka Pa'akai 0 Ka 'Aina vs.the Hawai`i State Land Use Commission(LUC). Puakea Ranch and its vicinity were in use by Parker Ranch for more than 70 years. Masa Kawamoto was born and raised on the ranch and would often help his mother as she worked around the ranch. He once recalled that he would often go bird hunting with his brother to help his mother whenever the ranch owners would throw parties. Farming and bird hunting were traditional activities practiced by the local ranch families. Michael Gomes, a local historian and author, stated that the only activities that took place on Puakea Ranch were associated with cattle ranching. Those activities ceased at Puakea Ranch once Parker Ranch sold its Puakea holdings and the families were asked to leave. No traditional cultural practices or properties were identified within the project area and the proposed usage of the property will not have a negative impact on any potential traditional cultural practices or properties located in the vicinity of Puakea Ranch. I I I I I HAUN &ASSOCIATES I ii I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I Table of Contents I INTRODUCTION 1 Scope of Work 1 I Project Area Description 1 Methods 4 I BACKGROUND 11 Historical Documentary Research 11 I Previous Archaeological Research 28 Previous Ethnographic Research 30 FINDINGS 31 ICONCLUSION 33 REFERENCES 34 IAPPENDIX A: LAND COMMISSION AWARDS IN PUAKEA AHUPUA'A(FROM WAIHONA'AINA) 37 APPENDIX B—WEST HAWAII TODAY AND KA WAI OLA PUBLIC NOTICES 43 IFIGURES Figure 1. Portion of 1995 USGS 7.5' Hawi Quadrangle showing project area 2 Figure 2.Tax Map Key(3)5-6-001 showing project area 3 I Figure 3. May 15,2018 aerial view of project area vicinity from Google Earth 4 Figure 4.Current extent of Puakea Ranch 5 Figure 5.The Cowboy House(view to northeast) 6 111 Figure 6.The Toy Box(view to east) 6 Figure 7.Yoshi's House(view to north-northeast) 7 Figure 8. Entry to Puakea Ranch from Akone Pule Highway(view to north-northeast) 7 I Figure 9.Tree-lined driveway leading to Yoshi's House(view to southeast) 8 Figure 10.Vegetable garden (view to north) 8 Figure 11. Maintained lawn (view to southeast) 9 Figure 12. Maintained lawn (view to southeast) 9IFigure13. Ahupua'a boundaries 12 Figure 14. Map of the North Kohala District from Tomonari-Tuggle(1988:4) 13 Figure 15, Map of the North Kohala District at Contact from Tomonari-Tuggle(1988:17) 14 IIFigure 16.Tomonari-Tuggle's(1998) map of the Kohala Field System showing project area 16 Figure 17. Portion of Lydgate's 1893 Hawai'i Register Map 1705 20 Figure 18. Map of the North Kohala District in the Later 19th Century from Tomonari-Tuggle(1988:41) 22 I Figure 19. February 13, 1920 article from The Pacific Commercial Advertiser(from newspapers.com) 23 Figure 20. February 9, 2932 articles from The Honolulu Advertiser(from newspapers.com) 26 Figure 21. Portion of 1930 USGS Hawi Quadrangle showing project area 27 Figure 22. 1976 USGS aerial photograph of project area vicinity 27 I Figure 23. Previous archaeological work 29 Figure 24. Masatsu Kawamoto at Puakea in the home he was born in (courtesy of Christie Cash,taken 30 Oct 2018) 31 ITABLES Table 1. Land Grants in Puakea Ahupua'a 18 ITable 2. Previous archaeological work in Puakea Ahupua'a and surrounding areas 30 HAUN &ASSOCIATES I iii TMK: (3) 5-6-001: Por. 082 Report 1516-011819 INTRODUCTION At the request of Christie Cash, Haun & Associates conducted a cultural impact assessment (CIA) of a 14.92 acre portion of TMK: (3) 5-6-001:082; a 32.411 acre parcel in Puakea Ahupua'a, North Kohala District, Island of Hawai'i (Figure 1 and Figure 2). The objective of this CIA is to identify any culturally significant resources or traditional cultural practices that occurred within the project area and its immediate vicinity. The CIA relies upon archival research focused on historical documents, previous archaeology studies, previous CIA reports, and oral interviews. This assessment addresses potential cultural impacts that future development could have on any traditional cultural practices or resources following the framework set forth by the Hawai'i Supreme Court in the case of Ka Pa'akai 0 Ka 'Aina vs. the Hawaii State Land Use Commission (LUC).This CIA attempted to make specific findings concerning: The identity and scope of "valued cultural, historical and natural resources" in the I petition area, including the extent to which traditional and customary native Hawaiian rights are exercised in the petition area; The extent to which those resources, as well as traditional and customary native Hawaiian rights,will be affected or impaired by the proposed action; and The feasible action, if any, to be taken by the agency to reasonably protect native Hawaiian rights,if they are found to exist. This CIA is prepared in conjunction with a Special Use Permit application for the County of Hawai'i I Planning and Building Departments. The landowners propose to operate the Puakea Ranch as a "Guest Ranch". The CIA was conducted between August and December 2018. Described in this report are the project scope of work, methods, background information, CIA findings, potential impacts to traditional cultural practices,and mitigation efforts if applicable. Scope of Work I In order to satisfy Act 50 of Ka Pa'akai 0 Ka 'Aina vs. Land Use Commission the following specific tasks were determined to constitute an appropriate scope of work for the project: 1. Conduct background review and research of existing ethnographic, historical, anthropological, sociological documentary literature relating to traditional cultural practices and resources in the project area and its immediate vicinity. I 2. Identify and consult with individuals and organizations to identify knowledgeable individuals with expertise concerning the types of cultural resources, practices, and beliefs found in the vicinity of the project area 3. Conduct ethnographic/oral historical interviews with knowledgeable individuals;and 4. Prepare and submit a CIA Report Project Area Description The project area is an irregularly-shaped 14.92 acre area located within Puakea Ranch at elevations ranging from approximately 530 to 605 feet. The elevations presented in this report are in feet above mean sea level (AMSL). Figure 3 is an aerial view of the project area taken on May 15,2018. HAUN & ASSOCIATES I 1 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I Map Location i i Up NaHONOKAA x WAIMEAT \/, a , Hllo e if KAILUA I mFk ( W',/0"-...- 4. P OA 1 I A. P Tanks AHALA Nibs, 1. EHU As kflaiJIIIfilrak s C \ of 1 = . co 1 U A 7 \ ihilliii) Oi N 400 • G J o r w-y 4..... ibillik '''. * I T A A u 1 1P° 15111V ill (---- 6\. . . VC 1---\---- A--) s t4. Si ... • . ...et tit 1 if/. 3),, 4 ifif fkIIkv sdri • s se permit area 5 111 7:47-117. _ 112-11016 r\--"-. K u k c ) s d r-- zN-"- Th-___./-----\. 7--- -- 4' babbft - KAHOLA HISTORICAL S TES, P CS..i STATE MOND,MENT g" L_. Ampi IFigure 1.Portion of 1995 USGS 7.5'Hawi Quadrangle showing project area HAUN &ASSOCIATES 12 I 1 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I D v 1:i i-_—a Z Y T-•'- ,' a ' -u 5 p.=tying. I 04•1e0.'4?\ 1 L% r t 1"0;10 uwr j_414L.,.T . i •.(111 ti I 1 , L t'i lI t\* 19' - '>11 '''..Cf / tA) 461 • •‘'t\ z, ,, I ,--,,,- -'4 .-k4-%'"' '__1 win 4, 00041. e4trt \ a LL., zu.54.' f0:::'' 0, _,....\ s s , i \ i I air 4t t i'k;•0)'.) k . yam/ , W Ori 0 4( itili.7 if i I l W as ,,, 2 Cr L f If1b ° I S.1 VV. 4 o° J 4'o 41 11, 1.' s $ 0\ ill/10 1\- 7 , ci", * , 'Ri fel 4 1\... r 111A. i:11 I --...,,, 110. « O3orht O 0 • a 2 / Y t 119 a u - q f0 ilkli irt:4 / c IIIIII La A at! 1tit i t r 4 , . Aga 1 Q E;t. A ',0 ,r r ,n 171 ii 9-7.I Q `,, 1.111 ff ,2a J of N.. 1? !g kAi N 3OPars' 7rnfn,-.._xa__._.__._Xp 00 HAUN & ASSOCIATES 13 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I Weifistoom/ s. I i TMK:(3)5-6-001:082 II I I p. k- 1 F`w IFigure 3.May 15,2018 aerial view of project area vicinity from Google Earth The Puakea Ranch headquarters was purchased by Christie Cash and her partner James Nelson in 2005. Their desire was to create a "low impact, eco-minded, low-density place for families that was anIalternativetotheresorts." (https://keolamagazine.com). She took great efforts to restore the ranch buildings to their original condition and today the Puakea Ranch provides overnight accommodations for I tourists.The area was informally recorded by the landowners in a June 2009 National Register of Historic Places Registration Form. The ranch buildings were subsequently assigned SIHP Site designation 50-10-2- 9107. The current extent of the facility, comprising the 32.411 acre TMK: (3) 5-6-001:082 is depicted in I Figure 4. The buildings consist of following: The Saddle House, James Cottage (built 1920s), The Cowboy House (1880s; Figure 5), The Toy Box (Figure 6), The Tool Shed, The Chicken Coop, The Tree House, Yoshi's House(19405; Figure 7)and Miles Away(1930s). IThe special use permit area is accessed by a gravel and dirt driveway that extends inland from the Akoni Pule Highway (Figure 8) and a Java plum tree-lined driveway (Figure 9) leads Yoshi's House at the eastern end of the property. The project area is bordered on the east, west and portions of the north and south Isides by rock walls. It encompasses the structures described above along with a vegetable garden (Figure 10), a pavilion, and pasture. The majority of the project area is comprised of a maintained grass lawn Figure 11 and Figure 12) and areas of dense guinea grass (Panicum maximum), with stands of koa haole Leucaena glauca)and kiawe(Prosopis pallida).Additional vegetation in the project area consists of night- blooming cereus (Hylocereus undatus), hibiscus (Hibiscus tiliaceus), macadamia nut (Macadamia integrifolia), royal poinciana (Delonix regia),Java plum (Syzygium cumini), monkey pod (Samanea saman),Idragonfruit(Hylocereus undatus), and various ornamental plants. I HAUN &ASSOCIATES 14 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 2(004444.41.-00/0044401 11114S f`1.• A CAW:. 4 .2t S 4,. 4f 4 71.04.24 74,14.444 1 ' 1. S •<e 1.!k: / W ! t0. 7 44,..v4,iv,„...4..,4f} LOTit$ xr GOWMYNOtfEt7$75 4;,. s+o111Mi°' r•runt.`.47..04 140.)04 r1St•0wwAHa.14 m, N rtt 1404 x, .. tr`s S t N{) / fl EX!U'J t ia4.,'" fJ."H CkEw CoOv LL- JAVA PLUM I A•!E h.F,Too.,NPv Special use permit -a n jyX.,. rr 7$1,:'F: r, #L futAt.•Pru t qRf 4 µ 4li tt - - TtmA J` rAOLFETON!t S ' f T4?` ItoI - -" 4,r' (' A s' rpt ''T -'r ...,,,...,.;^ v ..:. -" •`,p ,,t ELAw. t fix r 1 x4.441 fWweRJJ• YYC NAtiVE F4 WAOIH Po„,, iit'R"lt/T44EE 140414 L - ---- fnrSyy FMt KAIAFU d ,. ! 4mrP 5114.441,NAvb,i t 9441 q4,7,r,4.;n Sg1 14 A Y OFry I .-i ... WWu.P......,,.9.....,n P Figure 4.Current extent of Puakea Ranch I I I HAUN &ASSOCIATES I TMK: (3)5-6-001: Por. 082 Report 1516-011819 tl 'A.4 t 4+ A .- r . 04r 9P4. t AlI I II Figure 5.The Cowboy House(view to northeast) I ts- t:e". ...ylimr,--.!fr3F V.,,:---- 9. 1. . , . r„, 1 r F *.l..-11:4 +.,4 k y 0r k' y is I Figure 6.The Toy Box(view to east) 111 HAUN &ASSOCIATES I 6 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 1 1 Figure 7.Yoshi's House(view to north-northeast) I 01014eit. 410,d06, I i i F,.i +4b•Po',1,"i *r7'Mrt.,=;... ..... ,"Yr.. ,r" .w n?l. 'Y'$''•Vl'/d;u,,,.-,. ...,N riv/"." P`..u,..y:.H,,, "mM'' 3*'`e a'+rd,.x"..M`A ,.Arm• a ^d" :'`F.tc r r'. Mryw..a, '-x, Figure 8.Entry to Puakea Ranch from Akone Pule Highway(view to north-northeast) HAUN &ASSOCIATES 17 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 AA..‘•+ 'Alir - 1r,t... r-,,4 •,,, I V t, 44 At r, 4 7 pi ff.- .. At: .1 I IP r '1k • z} • • fir OI 1f,lit L. s;I t, N., •st , »w 1 fr,s, ' . ‘.. i v * Figure 9.Tree-lined driveway leading to Yoshi's House(view to southeast) I I L t 1 i i 1 a ..P.k y ... .r . y". 'rrz»: A'._..,. a.` w . r.i a.;5' . ... Y'i ``r< pw. xQ0 IFigure 10.Vegetable garden(view to north) HAUN & ASSOCIATES 18 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 A 116 Figure 11. Maintained lawn(view to southeast) 404. 1 111 r- W Figure 12.Maintained lawn(view to southeast) I HAUN &ASSOCIATES 19 410 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 Methods Archival research was conducted at the Hamilton Library Hawaii and Pacific Collection at the University of 1 Hawaii-Manoa, the University of Hawaii-Hilo Hawaiian Collection, the Land Survey Office and the Archives Division of the Hawaii Department of Accounting and General Services, the Bishop Museum Archives, State Historic Preservation Division library, State Survey Division, and the Hawaii State Public Libraries in Honolulu and Hilo. Informal "talk story" interviews were conducted with knowledgeable individuals in a manner that allowed I the individual to discuss the issues that were most important to them about the project area and the proposed project. The individuals that chose to participate in this CIA were residents of Kohala and were knowledgeable about the area. I I I I I I I I I I I I HAUN &ASSOCIATES 110 1101. TMK: (3) 5-6-001: Por. 082 Report 1516-011819 BACKGROUND Historical Documentary Research The project area is situated in the ahupua'a of Puakea near the end of Hawaii Island (Figure 13). The project area is located within the boundaries of the historic Puakea Ranch headquarters area and is situated approximately 100 meters inland of the Akoni Pule Highway (Highway 270). The project area is located approximately 800 meters seaward of Puu Ula. An unnamed puu or hill is located adjacent to the project area to the north. Puakea is literally translated as "white blossom" (Pukui, Elbert and Mookini 1976: 191). The ahupua'a originates at the shoreline between Puakea Point and Hianaula Point and extends inland 4,100 meters 2.5 miles) to approximately 1,240 ft elevation. It is bordered on the north by Honoipu Ahupua'a and on the south by Kukuipahu Ahupua'a. Tomonari-Tuggle (1988) presents a comprehensive historical overview of the North Kohala district, separating the area into two distinct geographic zones; the windward and leeward areas which are divided by the ridges of the Kohala Mountain range in a northwest by southeast direction (Figure 14).This line extends between Pu'u Kahone in the northwest to Pu'u Pili in the southeast and serves as the demarcation between the dry leeward side and the relatively wet windward side. The project area is located in the leeward area.According to Tomonari-Tuggle(1988:5): The long ridge of Kohala Mountain lies perpendicular to the predominant moisture- laden northeast trade winds and acts as a deflector, pushing the trades upward, where the resultant cooling condenses the moisture,forming clouds and rain over the summit. The rainfall decreases on the leeward side as the air warms in its return to lower I elevations. High rainfall is centered over the head of the windward valleys, where average measurement is 200 inches. At the mouth of the Honokane Nui Valley, it is 60 to 80 inches, decreasing northward toward Hawi where it is 50 inches per year. On the leeward side, median annual rainfall is approximately 60 inches at Pu'u Hue, which is 579 m (1900 ft) above sea level (Taliaferro 1959:136-137) and approximately 13 inches at Mahukona at the coast. (Tornonari-Tuggle 1988:132-133). Tomonari-Tuggle cites several historical accounts that document the extensive agricultural use of Kohala.The I extent of the agricultural fields at contact is presented in Figure 15. According to this figure, the project area is located in the area of non-irrigated agriculture. The During Lt. King's 1779 exploration of the Kohala region,he states: The country, as far as the eye could reach, seemed fruitful and well inhabited...[three and four miles inland, plantations of taro and potatoes and wauke] neatly set out in rows. The walls that separate them are made of the loose burnt stone, which are got in clearing the ground; and being entirely concealed by sugarcanes planted close on each side, make the most beautiful fences that can be conceived. [The exploring party stopped six or seven miles from the sea] at the second but they found among the plantations...To the left a continuous range of villages, interspersed with groves of coconut trees spreading along the sea-shore;a thick wood behind this;and to the right,an extent of ground laid out in regular and well-cultivated plantations,as far as the eye could reach(cited in Tominari-Tuggle1988:16-18). HAUN &ASSOCIATES I 11 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I U imb f. ,.v T mor n\\ LimukokoPoint___- 1 v rUmtwaBay , r \\ mAA7 N._ UpoWAirport Road- N 1.\ N.N. v N v I/ N. s \ N 1,6-'-'\,..v.--,767. r\ N. N C. \ 4- v A % \ Honoipu Landing I '\. C 9 \ t A vv v 2, N NolanaBayr f V Akooi Pule Hwy \Aiti0 A (Hwy 270) a SDG A GGAh4 N. t.Fo J7 f I N 4_ 1 soo 34iiillt: 3IrTMK.(3)3x-001082,/ 8POoi . N J f V J N. 1 N KUKUtPAHUIt' 1 N Kim Ditch 1000 IAkoni PuleHwy i Hwy ) l L`_ tr so0 i Contour Interval=200it 400 3000tt Ahupua'a Boundary DRch 1 IFigure 13. Ahupua'a boundaries HAUN &ASSOCIATES 112 TMK: (3) 5-6-001: Por. 082 Re.ort 1516-011819 l+raita P+ K,01-1AL,A FlqUR.E.. I. r..., THE. DISTRACT OF NOR,TH KOALA AnaGiNgA>0.146, ISLAND OF i-lAWAI'l w. .. ) iNor ,.sour a 1 2. 3 Mt.S.'-' 0 1 z S 4 its Puma rV KA*u ', •' r Ka L..16 I if:vita Pt WiNDWARP KIALA 5LOPE..5 c..., 1 WINDYNQD ict,4: i i ) ILMLA CON.C.NE.S lianotpw Kauhuta Pt 11'Pli'111Katlone kapw•bt BAT IN KA: • Ap rapana‘a bay14Awifi ' PA'AU IkeaktaNT i/ , t fati‘u 4IIW NIIALJ:1 Num bsT iarea14se t f r -•-st:! ,WINDWARD I e I 9 VoIo115 vAt.A.zys I:, lionok.inc.Nui s- • ii . • it) : 1 i i • i Minukana I 4v i (\ KoaVe, Piet.Hut. tZle."FT) I 1 1 1 k.1 f', 1P'u Ksi.cna tZsz,FT:• 3 1...:11.k.Jola 1,585 12.EV10.21, ii 1 z 111 4). --- too i,iLitawanut 1>al 1/ r ......-..."-- 7:i' ..," .... t if ,•-# •-i* i- f ii 0,-,''' Wa4k.a`Tho NT V N Kai Iiipab. 4••••••.. I I Figure 14.Map of the North Kohala District from Tomonari-Tuggle(1988:4) HAUN &ASSOCIATES 1 13 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 1 1 MQ1?41N1 MirIAid r j rr 0 •tato 4PA s a"-..-, ...--"--,....--",„> •1!... s KAUHPU&PT. a..•IVO 4 i. Mwa' r _ 4- a.-. ' 4 „4:-!... Vii+ NAPU'N EAT 1 4 A .. .? -,.•j.,,, ..-^', r.y is KAPANAIA 5A r.proj '....---:/.....- re d' F :°=•" .- . E.OKEA8A^( i--'' area ',,//i" 7:c s••••: ,-..„. 4'•r->" j ° o mMHy i-^-•' •.-"'ii_.-a`, aTa't_"' a A NUE DA`( AAA,,,q HUAK +44C=„'! %';,//.• %, , 4-.1.-:1,,,,17:„,.... tKJONAYI {.- 40411.0,.....---,/,. e-. r / .. i' .„7,........,r, ."f, / ` i .: . / ..rmeal sier: ft. '4_ JAMA 3*-,„.< c- -; NYNUWNtci ` ''' 3 IriAH{if'ANA •-"1"9" . ''=ice/ Kukuwkl Ji s„ w un+ALOtAa iuir t0 " A '. i '.'"e..' 7.,"--- . Pier Kw Y .. uwlAs otAa t.°° fi' ri z_ KENWA ldI C JA LiMkteli-.......: 1...... 3.,.......;,...„.....„-- ii P ° y' KANM9Y WKZAANNI ' Y . S004. 4 •v. v a' 'r 0,1, J —-.,..1W 4.. i 47';' i" r-p S oa i j t! WAIAKA'IUO GAY t'‘‘‘\41 FuuuRE 3. NORTH KO14ALA AT CONTACT u,,' PAr= The. LATE leth CENTURY KNOWN AQEA4 Of pie-TTLCMENT INFCRREP ARCA , OP SETTLCMCNT 11/Z.W ARGA9 of NON-If.R.IGATED a aeIcMLTtiQE. ory/ AREAS OF IRRIGATED AGBIGUL.TNR. 0 1 r.3 0.11 A NCIALI L,.'..., I 0 I i 3 4 tun uwua ANUPUA'A A UNDCR :ANC. ANUPNA'A NAMES PROM '04*5 KONALA UNION CNU2414 MCM ttfinv&P GOOK., L:cATION TAKEN PROM RI, NNIS TOPARAPNIL MAY-6' 3ERIE4- I Figure 15,Map of the North Kohala District at Contact from Tomonari-Tuggle(1988:17) HAUN &ASSOCIATES 114 I i TMK: (3) 5-6-001: Por. 082 Report 1516-011819 Similar observations were made in 1793 by Archibald Menzies and in 1823 by William Ellis.According to Ellis, Streams of water were frequent, and a large quantity of ground was cultivated on their banks, and in the vicinity(1963:19)",and Menzies states: From the north-west point of the island ['Upolu Point], the country stretches back for a considerable distance with a very gradual ascent, and is destitute of trees or bushes of any kind. But it bears every appearance of industrious cultivation by the number of small fields into which it is laid out(cited in Tominari-Tuggle1988:20). As indicated above,the project area is located in Tomonari-Tuggle's(1998) Leeward area.The agricultural use of this area is characterized by a," ...massive field system [the Kohala field system] which sweeps across the leeward slopes of Kohala [and] reaches the coast at the ahupua'a of Kukuipahu" (1988:11-23). This field system extended from the shoreline inland to the forests, and was characterized by cross slope walls designed to block the prevailing trade winds. Using aerial photographs, Tomonari-Tuggle created a map depicting the extent of the Kohala Field System (Figure 16). As indicated in this figure, the present project area is located along the northern fringes of the complex. The North Kohala District is of particular significance as the birthplace of Kamehameha I, who was born just to the south Mo`okini Heiau (see Figure 15).The district was also the place where his armies gathered to prepare for war and was a training ground for young warriors (I'I 1959:15). According to the National IParkServicewebsite, the Mo'okini Heiau is one of the first luakini or sacrificial heiau in the Hawaiian Islands. It is described as follows: Tradition says that a temple was first built on the northernmost tip of the Island of Hawaii sometime in the 5th century by the high priest Mo'okini. Later oral tradition says that the current heiau was built on the older temple between the 13th and 14th centuries by Pa'ao, a legendary priest from either Tahiti or Samoa who is said to have introduced the Hawaiians to human sacrifice, the walled heiau, and several types of kapu—the system of religious, political, and social laws that governed every aspect of daily life. Pa'ao was said to have lived near Mo'okini Heiau and founded a lineage of priests that served the ali'i 'ai moku (paramount chief) of the Island of Hawaii through the early part of the 19th century.111AncientHawaiianshadmanytypesofheiau, each with their own distinct function and use by particular segments of society. Heiau ranged in size from single upright stones to massive and complex structures. Larger heiau were built by ali'i(chiefs), but the largest 1andmostcomplex, the luakini heiau (sacrificial temple), could only be constructed and dedicated by an ali'i'ai moku.Luakini heiau were reserved for rituals involving human or animal sacrifice and were generally dedicated to the war god Ku. Rituals performed at a luakini heiau highlighted the ali'i 'ai moku's spiritual, economic, political, and social control over his lands and his authority over the life and death of his people. Mo'okini Heiau was active through the early part of the 19th century and was Kamehameha l's war temple, housing his family's war god Ku-ka-'ili-moku before the transfer of the god to Kamehameha's new war temple Pu'ukohola Heiau, 21 miles down the coast near Kawaihae. Kamehameha I's son and heir Liholiho also used Mo'okini Heiau. In 1819, after his father's death, Liholiho ended kapu and abolished that part of the Hawaiian religion that depended on heiau. In spite of royal orders that they be destroyed, Mo'okini and several other large heiau were spared. It was believed that they had acquired mana(spiritual energy), which protected them against human destruction. https://www.nps.gov) HAUN &ASSOCIATES 115 i 1 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I Po l' ulltlll turo 'i t Otlyl:' !e1 ir li illi .'.,, IH<l>ItfdV1 1a«1 s tlltemt nlinannulliiii . 1 91Iq n,ws.ni YWtER»i' n l uitIIII111Ill1lig 1 1 I Ai1111I ( i!11 Wiliffitterti Rt4111,111 la 1I I NT 1 MB!lira!illitttlt!lftin „ 71biaL tom; 111111 fit S i 7_ M e ,,If111 11 Si.". 111; I tIL--------- fItl: 1 1 1Ettt1 'II61-, . 1_ 1 t tpa® " e. I rta "' iaiC•+ t cou I 1 V l EraP. lcu c i hilt ign It} , Iia 0 h fr Jl , j ants I 01v 1l! d V,", aniit s'kr ' 11 y r if N EA i i 2 V4 1111Iv Ito b lbt1 '1/ ' / vs R IIEiii a, 15 0.oa !._ i l / t r E Q J, 1 t11411 t 1i I S 01cnQ 130i4#:r -I).. Ce p. O wryr 00 ea O }— 4 4'i< r til , s ry 11/ t<' IT 43O u A pStildCO " totiv ti IL— ..JQ .. rp ri i vI1/ ea4IT. 4. HAUN &ASSOCIATES 116 TMK: (3) 5-6-001: Por. 082 Rej2ort 1516-011819 In January 1778 Cook landed in Waimea, Kaua'i and the culture of old Hawaii began its spiraling change Day 1992). Cook left Hawaii for several months, but returned later in the year. Kalani'opu'u was fighting Kahekili's forces in Wailua, Maui on November 19, 1778 when Cook's ship was sighted on his return trip to the islands. Kalani`opu'u visited Cook on the Resolution, while Kahekili visited Clerke on the Discovery Kuykendall and Day 1976:16). When Cook sailed into Kealakekua Bay on January 17, 1779, Kalani'Opu'u was still fighting Kahekili on Maui.At this time Kahekili's brother Ka'eo-kulani was ruling chief of Kaua'i; Ka-hahana was ruling chief of O'ahu and Molokai; Kahekili'ahumanu of western Maui, Lanai and Kaho'olawe; and Kalani`opu'u was ruling chief of Hawaii and Nana (Kamakau, 1992:84-86, 92, 97-98). On January 25th Kalani`opu`u visited Cook again at Kealakekua Bay, presenting him with several feather cloaks. In February Cook's plan to kidnap Kalani`opu'u as a hostage was thwarted and Cook was killed following a skirmish over a stolen 111cutter(Kuykendall and Day 1976:18). Following contact with Westerners, the population of North Kohala declined significantly. According to State Statistician Schmitt (1977:27), between 1832and 1835, the population in this area declined 26%. This decline was due in large part to the introduction of diseases by the early visitors. This decline accompanied a shift in settlement away from the leeward coasts to the interior and to windward areas. The economy of the islands experienced change as industry and capitalism emerged.The sandalwood trade was established by Euro-Americans in 1790 and by 1805 had become a burgeoning enterprise(Oliver 1961). By the 1820's,the sandalwood trade was wreaking havoc on the commoners who were weakening with the heavy production, exposure, and famine just to fill the coffers of the ali'i who were no longer under any control constraints (Oliver 1961:261; Kuykendall and Day 1976:42; Bushnell 1993:212). The lack of control of the sandalwood trade was to soon create the first Hawaiian national debt as promissory notes 111andlevieswereinitiatedbyAmericantradersandenforcedbyAmericanwarships(Oliver 1961:261, 262). In the 1820s, the sandalwood trade was at its peak and every tree found was cut for its value. The forests of Kohala, which reached almost to the Kawaihae shore as late as 1815, contained an abundance of the coveted wood, presumably the dry land species"(n.a. 1967:16). The Hawaiian culture was well on its way towards Western assimilation as industry in Hawaii went from the sandalwood trade, to a short-lived whaling industry, to cattle ranching, and the more lucrative, but insidious sugar industry. Sugar cane was grown on all islands and when Cook arrived, he wrote of seeing sugar cane plantations. The Chinese on Lana'i are credited with first producing sugar as early as 1802; however, it was not until 1835 that sugar became established commercially, primarily to replace a waning sandalwood industry(Oliver 1961:263; Kuykendall and Day 1976:92). In the 1840s, political acts of the Hawaiian Kingdom government would change the land tenure system in Hawai`i.All lands were segregated into one of three categories: "Crown Lands" owned by the occupant of the throne, "Government Lands" controlled by the state, and "Konohiki Lands" controlled by the chiefs; and "were all subject to the rights of native tenants" (Chinen 1958:29, Beamer 2014:143). In 1846, King Kamehameha III appointed a Board of Commissioners commonly known as the Land Commissioners, to confirm or reject all claims to land arising previously to the 10th day of December, AD 1845." Notices were frequently posted in The Polynesian (Moffat and Kirkpatrick, 1995); however, the legislature did not acknowledge this act until June 7, 1848 (Chinen 1958:16; Moffat and Kirkpatrick 1995:48-49) and the act is known today as The Great Mahele. In 1850, the Kingdom government passed laws allowing foreigners to purchase fee simple lands (Speakman 2001:91). The Kuleana Act of 1850 allowed for fee simple land ownership by commoners. HAUN & ASSOCIATES I 17 I TMK: (3) 5-6-001: Por.082 Report 1516-011819 IThe Waihona 'Aina (2000) Mahele Database; which is a compilation of data from the Indices of Awards Indices 1929), Native Register (NR n.d.), Native Testimony (NT n.d.), Foreign Register (FR n.d.) and Foreign Testimony (FT n.d.) provides information on the Land Commission Awards (LCA) during the Mahele. This database indicates that two claims were made in Puakea Ahupua'a. LCA 8746 was claimed by Keawe and LCA 8879B by Kamalamailalo. Only LCA 8879B was subsequently awarded. The location of I this LCA is not depicted on available tax maps of the area. LCAs 8746 and 8879B are presented in detail in Appendix A. I LCA 8746 to Keawe describes an enclosed house lot with two houses, in the 'ill of Laleakone with two houses on it surrounded by public land. The land passed from Keohokalole to Kekuannui and from Kekuanui to Keawe. LCA 8879B to Kamalamailalo describes a fenced house lot with five houses, three of I which were owned by Kamalamailalo and two that were owned by his father Kaulemamoku,The land was owned by Kamalamailalo since the time of Kamehameha I. The land of Puakea (and the surrounding ahupua'a) were divided into land grants between 1852 andI1862. Figure 17 is a portion of Lydgate's 1893 Hawai'i Register Map 1705 showing the project area obtained from the Archives Division of the Hawai'i Department of Accounting and General Services C http://ags.hawaii.gov/survey/map-search). This map indicates that there are nine grants in Puakea Ahupua'a. Table 1, compiled from information obtained the Waihona 'Aina (2000) Mahele Database indicates that these grants ranged in area from 18 to 320 acres. According to Figure 17, the majority of L the Puakea Ranch Headquarters area (TMK: (3) 5-6-001) is situated in Grant 2361 to Henry Christenson, with a small portion located in Grant 1999 to Kahionamaka. The present project area is located in Grant 2361. Table 1.Land Grants in Puakea Ahupua'a Grant Grantee Ahupua'a Yearobtained Grant acreage P744 Paahao Puakea 1 1852 50.2 745 Kaniho Puakea 1852 18 1549 Kaluhilau Puakea 2 1855 24.7 1550 Malamailalo Puakea 2 1855 88.5 1958 Papa Puakea 1855 19.32 1999 Kahionamaka Puakea 1856 107.65 I 2361 Henry Christiansen Puakea and Honoipu 1857 1861 320 2777 Henere Puakea 32 2848 Henry Christiansen Puakea,Honoipu and Lahuiiki 1862 77.3 By 1858 at least 2,119 foreigners lived in Hawaii. Many were merchants who traded and provided provisions, ranchers and missionaries, who lived in various locations throughout the islands. "Foreigners engaged in agricultural pursuits with the idea of reaping a profit from the land, in contrast with theIHawaiians, who carried on...subsistence agriculture" (Coulter 1971:11). In the 1860s, the U. S. Civil War brought about a boost for the sugar industry in Hawai'i as sugar plantations in the South were boycotted I or destroyed. And while Rev. Lorenzo Lyons was busy building churches; Imiola in Waimea, Hoku Loa at Puako and one at Kawaihae(n.a. 1967:18-19), Rev. Elias Bond was getting involved in the sugar business. In 1860, Rev. Bond engaged his "long-time acquaintance" (Stephenson 1977:7), Samuel N. Castle in Ifounding the Kohala Sugar Company on lands owned by Bond and his neighbor Dr.James Wight.The first crop of the Kohala Sugar Company was harvested in January 1865(KTF 1975:69). Kohala's transition was a I reflection of what was happening elsewhere in Hawaii, as the sugar industry grew. The industry brought HAUN &ASSOCIATES 118 TM K: (3) 5-6-001: Por. 082 Report 1516-011819 in tens of thousands of laborers from Asia, Europe, the Americas, Oceania, and Africa to work on the many plantations and mills that were being established on all major islands (Oliver 1961:123). Bond's influence on the expansion of the Kohala sugar industry is described by Tomonari-Tuggle: When Elias Bond directed his efforts to initiating sugar as a major agricultural industry in Kohala, he could not have foreseen the incredible success at his modest venture. His primary 111concernwastodevelopameansforHawaiianpeopleofthedistricttocompetesuccessfullyin the market economy that had evolved in Hawaii. What resulted was a vigorous, stable, and competitive industry which survived over a century of changing economic situated. For the Hawaiian people,however,the impact was not what Bond anticipated. The "triumphant march" brought along not merely a strengthened economy but a new and prevailing resource,the sugar industry,which abruptly interrupted the process of indigenous adaptation to Westernization and instituted fundamental changes to the demographic composition of the community,to the organization of settlements,and to the patterns of land use. Kohala during this 50 year period was a frontier community characterized by a variety of people, settlements, and commercial ventures. Newcomers to the district were filling an economic void with numerous and diverse endeavors,from which only a few would emerge successful. The void presented a challenge and what already existed in the district was insignificant in terms of what could potentially develop. The nature of the community and the organization of land was drastically altered. The Hawaiian population,already decimated and outmigration,was insufficient of the needs of the market-oriented agriculture, and waves of immigrant labor from the Orient, Portugal, Puerto Rico and the Philippines arrived. Americans, British, and other northern Europeans came as managers and administrators. All were pioneers, leaving family, friends, and homes to seek better lives in the Kohala sugar frontier. The sugar mills and their associated plantations held a collective preeminence as major agents of change and development in the district. Kohala Sugar Company. Bond's model for economic security,was incorporated in 1863.After a decade of struggling,the company finally showed a credit balance in 1872, which coincided with the Reciprocity Treaty of 1876 between the United States and Hawaii.Although Bond maintained a paternal watch over the welfare of his congregation of laborers, his influence in the operation of the mill and plantation eventually waned before the demands of the profit-motive and his increasing age. By the time of Bond's death in 1896,the company was flourishing and competition had arisen Iintheformoffiveothersugarmills.Spurred on by the Reciprocity Treaty,sugar pioneers saw the potential of commercial development in Kohala. Dr.James Wight, one of the early haole residents of the district, started the first of the other mills in 1873 at Halawa. In 1874, Union Mill and Plantation Co.started by the Hinds of Maui and later headed byJames Renton,was set up in Honomaka'u.Judge C.F. Hart,formerly of Kona, moved to Kohala to start Niuli`i in 1877; originally milling native-grown cane, he soon expanded into a field operation as well. R.R. and John Hind moved to Hawi after selling Union Mill and set up the Hawi Mill and Plantation Co. and its two sugar-growing subsidiaries, Puakea and Homesteads Plantations in 1881. In an effort to improve operations,the Hawi Company constructed the Hoea Mill in 1904,Star Mill in Kapa'au,operated only briefly in the 1880s.(Tomonari-Tuggle 1988:40-42) HAUN &ASSOCIATES 119 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I Il 1w J Y 1 i i St, IF :ei 1. yr- ff i iIIrtry. j r l w I frfit kFt,f f^`^ t ` (( W,.././({ fes, r pif , ,1 kW s Vin., `•1 . Z i ttt;1 4' / fl: 1-1 z S''' / 11 )1 I 1\ E°F. H N n l I e g 0' v cn rit--7--1-i—ri- ,): /i . .,1 4 - I. ic , z i I, / k.1 I i moi, ci_ _ / s A /d b f00 s 1/ I. cuoff " j 0 f Lj / IV rn I Mj \ vY 13) o444\ 1" 11Nr°17 c. 0. ea I HAUN &ASSOCIATES 120 TMK: (3) 5-6-001: Por.082 Report 1516-011819 Figure 18 is Tomonari-Tuggle's(1988:41) map of the Kohala region in the later 19th Century depicting the above mentioned camps and mills.This map indicates that the project area was not under sugar cane cultivation.The burgeoning sugar industry also resulted in the development of a rail system used to transport the cane from the fields to mills. The demands of the successful sugar production stimulated the formation of two supportive enterprises. To service mills, the Hawaiian Railroad Company, started by S.G. Wilder in 1881 and completed in 1883, ran from Mahukona to Niuli`i over 17 trestles and almost 20 miles of rail. Previously dependent on ox-cart transport of cane to landings at Hapu'u Kauhola Pt.,and Honoipu,the mills,with one exception,now had efficient access to a landing at Mahukona on the sheltered lee side of the district. Hawi Mill continued to uses its landing at Honoipu. In 1884, the rail company carried 20,000 tons of freight and 6,000 passengers (Best 1978:43), proving itself a viable and nearly indispensable means of transportation. At the end of the century, the line was purchased by a conglomerate of plantations; again Hawi refused participation,although it eventually joined in 1912.(Tomonari-Tuggle 1988:42) In 1897, the Hawaiian Railroad Company was dissolved and a new company, the Hawaii Railway, was incorporated.The Hawaii Railway was sold in 1899 to the four Kohala sugar plantations that it served(Union Mill,Halawa Plantation,Kohala Plantation,and Niuli'i Plantation).The Hawi Mill and Plantation preferred to haul cane by wagon to its landing at Honoipu until 1912 when it also purchased a share of the railroad. Passenger service by the railroads ended by 1920 as automobiles became more common. The Hawaii Railway was dis- incorporated in 1937 and reincorporated as the Mahukona terminals.The railroad was eventually abandoned in 1939 (Best 1978:42-48). As indicated in Figure 18 the portion of the railroad in Puakea Ahupua'a is located approximately 1,100 meters seaward ofthe project area Not everyone was in favor the railroad and its impact the community. Conde cites an 1882 letter from a farmer whose land was being: ruthlessly destroyed by the railroad overseers of S.G.Wilder.This act is equal to that of plain murder, because the livelihood of myself and my family is reduced to nothing, that is. My plants and that of my family are covered with dirt,the taro, banana,ti leaves, coffee, mango, orange,bamboo,and other plants.My property is filled with fruits,but these days it is reduced to naught.(Conde 1971:40) The expansion of the Kohala sugar industry in the 1920s and 1930s required a significant labor force and i immigrants primarily from China and Portugal began arriving. The camps where the immigrants lived were typically located in close proximity to the fields so that the workers could walk to work (Schweitzer 2003). In order to supply the needs ofthe burgeoning immigrant population a variety of associated business emerged. The population of the region went into decline, due in part to young people being lured from the country to larger towns and cities, especially Honolulu. Between 1940 and 1950 the population declined 17% to I4,456 people. By 1960, there were only 3,386 people in Kohala (Schmitt 1977:12). In 1975 the Kohala Mill closed its doors because of the declining population and disputes between the unions and management. As discussed above, Henry Christensen purchased Grant 2361 (location of project area) and Grant 2848 in the interior of Puakea Ahupua'a and surrounding areas (see Figure 17). A sheep ranch was initially established along with some sugarcane cultivation; however, the latter was unsuccessful due to the crude equipment available at the time(Henke 1929:41). HAUN &ASSOCIATES 121 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I NOEA p uw,ps+ tGQ14Ie.L4 LNDCi. t•' *4. MILLI N40Y'N L.NOCt- Projec we eeim eta. KDMALA" '1e• area NAWI .mw• MILL Kt:OKGA I a :: w.u eNAMANIArucu. s:", MILL Kioi'aw ,C,e .rte„ Njtawa"`' wwul t s:" STAR FIALAWA e ' ;-0•• Mi LL. MIL.L. A NINU'1. ti - s.,= ji txitit M I L.L.: tee+Lf K3•jy: .• Z• I$••dl.::ii.43r{'.::Pt,ty o POLCILLt KILL CO. i SN6AR F!ELt75 A1lsNYKONA I o N1.R6aR.iwtni cQ.WU. r*MeT Orccx C.2k4PAM{ I e t/Pie IS NYC KANCM I — i I 0 KANNA RANCN I I FIGURE 6, NORTu kOWALA IN ME LATE. 19th CENTuzy i A 61.40AR. MILL I 1 TOWN Q AI L2OA0 3T4TION LAND iNOI L s Me10 WOO aa. OATH N i . 1 3 __ i 13ASEl, ON MAD FY LIONS {OE.* I Figure 18.Map of the North Kohala District in the Later 19th Century from Tomonari-Tuggle(1988:41) MO HAUN &ASSOCIATES 122 I I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 Christensen's land in Puakea and Kukuipahu were purchased by Dr. James Wight around 1875 and 1 subsequently established a sugarcane and ranching operation on the property. Dr. Wight settled in Kohala in late 1840s after a ship he was traveling on wrecked off the coast of Mahukona. He operated a drug store IintheareaandalsoservedasaCircuitJudgebetween1852and1863. He was later was elected to the House of Representatives and subsequently to the House of Nobles under the Hawaiian Monarchy(Clark et al. 2013:31).I Dr. Wight obtained a substantial interest in the Kohala Sugar Plantation and established another plantation in Halawa. He constructed an animal-powered sugar mill at Puakea According to an article in The Pacific Commercial Advertiser (precursor to the Honolulu Advertiser) a total of 1,118 tons of sugarcane were produced at Puakea in 1919 with an estimated 1,050 tons to be produced in 1920(Figure 19). THE PACIFIC COMMERCIAL AD' AR41 rid pt ss, , ,,, . .„...,....„...........,..„.......„..., Shipments To First of Month, 39,493 Tons{'' PbitP00000 o1 1131 Hs,raiiott as Mabokona,Fe,brworw 4,to,Pan Frao•la toFtdtrsary t TotaiM 3o,sen too+,ae ,took fbr faik,oiaa leer dipmaaret eoMre,po4 with 01,p34 tn.Aomori i Powke*y 194 tom to Western; VainTenney1,1919_ The fotto.1.$(clow Mil.401, Haws,904 taw tiro toe he, lath»will rho*lbw dipmeote for cath in to Crockett. The Lawn Johmoo's tytarciwifialsetrgo'uteri 3910 too* 1919 Sat* The Microns.treater rbebcta,waibag Punct Ern ton. .. ... 33,758 0$.4f7 Febroarc 7,took 831 toe for Crorkott.I Weereta ....... Uric 1,004 The Morrenfo took 8429 t,mOto Crockett Refined . .... ....... 1.$T1 '2.000 nal Sig tone of refitted. Lwbdln*o In Mat raters 1 Total ,. 39.193 61,033 Weataero to alit in the wear fixture i4hiptoenta wince February I bare will burl at porta awl take obipmtwt* Ipcn: Wenn.ttutwtw.1,145;tactor.', attpnrrimotety at felons: be 037: tefised,330—*yowl Wel It M oririta Part Aiteo. 3048 tram to'' date of 5:,903{ewe,of which 3403 tonl W,eterat Matta.H so'w'n an Kabw's%' is refitted. shoot 4000 teat 9iitera.to. Hnnntole i010a'*Tint Ilagjosst sad Mabukonn,3200'om,part WMietn; Penrrel milk have,shipper,their 900 Marhlra, Kahului. 32430, wit W'.a'erw.' mogntw aiwee 110 het report*ouch ago. The sloe of the,]teal's cacao I*ann. Otaa WWI 413 terns by the Karen resat tats. t7 Ma'conds,ulna walled from Knot*, The following tette*bows abifoouato lhtWedttnalwysthlaeoe,tr dipped it*Mt to Fehrary 1 by plantations 1Pattlls tot bar On Venni*,1900 tons;trod Thr Minn 74111 inns.**Honshu;Iso to'Mateo**thereon Aeale Johan*,tram clodee Koolau Aaricnitorwt, lot*tro ISO"t'.*tfw,m,w+ ..t'.«b.tt*rentI'Fop ' Hewett h0ba 10+00*t'r„ a.td moat t NO` Ibkwa 4o. 11300 04N3tNOM fsi,ors rreartTrititi 0'i'e. ............«..,....ton nun Peteekre near err. .. ................ant ,,....., OAK WSWilosM4wiit011.s0 tw....:............. i VsVW '. a000,0 Mbatnttaa t'a. lima ••, C , , 0wmr t'e.t„."............ ..... tfAM ..... 11,43 4" Pbtar$1.1par 01140 r............ ....... oxo Hat401 Plantar 90llnfatfew...,..........,.. I,70o .,.... {, lobi} Knob 0050* 4u . ...... ...... .,.•,... tint 7.fi331PolosMil0'w. 1808 11310 tptgy ri f11w 0.0024,, 4=.4.1.........4=t' nrkw Ploottotbw z. 1 t1*ton t newtb MPym ,, arm Y,toni Oita aerloottn! 'a................. 00+00 ...ZL2 00.0101 Totoi ,11,0,04 HO ...3,;:a;,: 4 ..., m. ,. Ate.. Figure 19.February 13,1920 article from The Pacific Commercial Advertiser(from newspapers.com) HAUN & ASSOCIATES ( 23 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I According to Henke's A Survey of Livestock in Hawaii, the history of the ranch is described below: I Dr.James Wight acquired the Puakea Ranch lands about 1875 and continued with the sheep ranch,the sheep at that time numbering about 7000 head of the Merino breed. Robert Mason acted as manager from about 1875 to 1882 and was followed by Hans I Martinsen,who continued till 1886,when J. H. MacKenzie became manager for Dr. Wight and continued to 1901. Dr. Wight about 1886 imported two Maltese jacks at a cost of $1400 and he was Iprobably one of the first men to breed mules in Hawaii. Since the sheep suffered from scab, and wild dogs killed many, cattle were substituted I for the sheep in the eighties and there were few or no sheep left after 1890. Two Shorthorn bulls were imported from California and bred to the native cattle and Shorthorn blood predominated on Puakea Ranch till 1901, although some Hereford I blood was introduced as early as 1889. Beef had little value at this time and many cattle were sold as work oxen for the cane fields. I While Mr. MacKenzie was manager water was brought eight miles from the Kohala mountains, some wells were dug near the beach and some fences built. When Arthur Mason became manager in 1901 the ranch had about 3000 cattle. During the next I twenty years Hereford blood gradually replaced the Shorthorns. Eighteen Herefords, eight bulls and ten cows were imported from Oregon in 1908 at a cost of$130 each and five bulls were imported from Kentucky in 1920 at a cost of$500 each. (Henke 1929:41- I42) Following the death of Dr. Wight on September 2, 1905 at the age of 91. The ranch was operated by Robert Shingle, E. H.Wodehouse, and A.W.T. Bottomley,trustees for the James Wight Estate. AccordingItoAdamsandAthens(1994:18) by 1910,8,758 acres of land were under the control of the Puakea Ranch. Water to the ranch and sugar mill were supplied by the Kohala Ditch, which supplied several plantations in the area emptying into a reservoir in Puakea. The supply of water was inadequate for the successfulIcultivationofsugarcaneandthelastcanecropwasharvestedin1930. (Clark et al.2013:31). According to Henke,the Puakea Ranch also included an area formerly known as Puuhue Ranch (1929:40). I The headquarters of the Puuhue Ranch operated as a separate ranch previous to about 1906 when an amalgamation with Puakea Ranch was effected which willg expire in 1930..."(1929:40). The characteristics of the combined ranches are described as follows: llThese combined ranches run from the sea to an elevation of about 4000 feet and have a total area of about 25,000 acres and at present have about 5000 Herefords, 350 light Ihorses and 10 Berkshire sows. Good Hereford bulls as well as females have been imported from time to time and the ranches at present have 85 range bulls and 75 selected females that are bred to IIII specially good bulls for the production of the range bulls.The range bulls are segregated from the cattle from July to February. I The rainfall at the Puakea Ranch headquarters has varied between 30 and 63 inches since 1920.The water needed for the cattle comes from the Kohala mountains. I HAUN &ASSOCIATES 124 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 Paspalum dilatatum has been planted quite extensively and has done very well. Koa haole(Leucaena glauca)is being experimented with as a promising low land forage crop. Pigeon peas (Cajanus indicus) have not been extensively tried, although results of such attempts as have been made with this legume have not been too encouraging. Plenty of Bermuda grass (Cynodon dactylon) and some red top (Tricholaena rosea) is found on the lower and intermediate elevations and Hilo grass (Paspalum conjugatum) is quite abundant on the upper lands. A scattering of Ohia lehua trees is found over the upper section with practically all their branches on the leeward side of the tree, which is indicative of the strong winds that prevail much of the time. The ranches are in need of more fences and paddocks to facilitate segregation and control of the animals at different ages and to give newly planted grasses an opportunity to get started while the cattle are kept out of certain sections for a time. These paddocks are included in the plans for the development of the ranches. Cattle are marketed from two years of age to about five, at which time they weigh about 450 to 650 pounds dressed weight. About 500 to 600 are shipped to Honolulu annually,with an additional 180 slaughtered on the ranch for consumption in the Kohala district.Cattle for Honolulu are loaded at Kawaihae.The Mahukona beach is not suitable for loading cattle on the Inter-Island boats. It is planned to reduce the number of horses which are kept for sale to various parties. No mules are produced on the ranch at the present time. (Henke 1929:41) As many landowners did, Dr. Wight brought in laborers to work the land, contributing to a wave of 185,000 Japanese immigrants who came to Hawaii in the 19' and 20th Centuries https://keolamagazine.com). Zenjiro Kawamoto and his wife Wasa Watabayashi immigrated to North Kohala from Hiroshima as part of the wave of Japanese immigration. They settled at the Puakea Ranch and moved into what would eventually be call the"Cowboy House" (see Figure 4).The Kawamotos raised three children at the ranch,consisting of Masato (Johnny),Yoshio(Yoshi) and Thelma and the family went on to oversee the operations of the Puakea Ranch for four generations. The Parker Ranch began leasing the Puakea Ranch lands from the James Wight Estate in 1932,agreeing to a twenty year lease agreement for a fee of$2,500 per year.The lease of the ranch land is memorialized in a February 9, 1932 article in the Honolulu Advertiser (Figure 20). The Parker Ranch eventually purchased the Puakea Ranch lands outright in 1944 and eventually purchased the land in 1944 https://puakearanch.com). Figure 21 is a portion of the USGS 1930 Hawi quadrangle showing the location of the project area and the Puakea Ranch headquarters. The headquarters are situated on the mauka side of the historic road that follows the path of the current Akoni Pule Highway. The map also shows a road extending seaward to Honoipu Landing and the railroad extending throughout Puakea Ahupua'a at approximately 170 to 200 ft elevation. A cluster of building is located inland of Honoipu Landing and three houses are present mauka of the railroad line. HAUN 8c ASSOCIATES 125 I TMK: (3)5-6-001: Por. 082 Report 1516-011819 1 SSttR.n.y PARKER RANCH BUYS KOHALA CO. LAND AND STOCK The Koht1. Ranch Co on Hamad baa been 4urehoed by the Parket ranch oared by 17-year old RichardSmartInart. •5300.000 deal. It Y an- nounced MondaynouncedMonday A 90-year leasehold of the Puate* ranch at an annual rental of 53.500dincludedInthetransaction. Th. Parker moth I. enlarged byapproximately1-.000 gale Y • re. Milt of the pure/mut.and 9.000 head 0t tank The Puakea ranch contains about5.000 acres and 4.500 head of eat- i' td, and the Schein Ranch 11.000 sores and..300 head of etoct. Alfred W. Carter If trustee andgeneralmanageroftheParkerrand erhlch operate.in Honolulu throughtheRavenMemCo. At one time the Rapala and Pus- ka.ranches were under an amatga. Matron Weenier4. the mamma KtheWightestatethenbeingKN.Wodebouy. A W T. Bottomley andRobertWblunt'. The trusteeahy., .Spared about ayearagoandatthattimetheWight estate lands vent to the beneactarls.In the latter part of 1531 the 10-year 1 dae.hotd of the Pt.*..ranch geRm.trey to the Ronela ranch ale el- mutedKoh.la Ranch Co.was IncorporatedonMarch141904. At the time of the execution oftheleaseholdtheKotulaRanchCo.purr heft. IS4 the »gnu of the parse MA Wight Puttee lednn1.. Figure 20.February 9,2932 articles from The Honolulu Advertiser(from newspapers.com) Figure 22 is a portion of an aerial view of the project area vicinity taken on December 20, 1976 by the U.S. Geological Survey and obtained from the University of Hawai`i at Manoa online library http://magis.manoa.hawaii.edu).This photograph shows the extent of the Puakea Ranch headquarters at this time. In the 1980s the Parker Ranch subsequently sold 200 acres of the Puakea Ranch lands to a real estate developer and the Kawamoto family and other ranch employees were asked to relocate. The Puakea Ranch headquarters, including the present project area subsequently fell into disrepair. 1 HAUN &ASSOCIATES I 26 TMK: (3) 5-6- I 001: Por. 082 Report 1516 011819 7.4„...._, r .„,„,'- '' ' '''''-''''' ,- : ' , , vii",' '' Niv/ 'L 114,.r,..4„),„,,,..„..!.: , , (,, i V b c' Q,..., f 4-14\: ' 4t.'''''''':-..-.4"14‘.''''‘„..4..-''',,i(/` C c.„. ,,.....,*•4 4/',',:•'"'krkqiL,,, sN•',,,,‘".•'?•'••*.,,.?... zr...,',....;;,,tm:;. 4P.,Y's*,Avt,.,..L...,\z,,,,.....",,,'' v., Z,,, a/Jz.:'."`:7;,,,,,,,t\•• . 4iNotie r. A)k i; , f4) .4.i..3, 6,...i. i.er, .,,,,t,,,(ii,f): . i Niirix 4,,,, . ,...".-.,--- 1 if.-.-7.---- i---_ , .,, ix. ‘ w t m- k 1 i. lb teli I c." rtµ \" 5 1 v , A e x' ii.e. s) i;-----=,_- . s. NL1 1110,41140.1111111001‘. \\,,,,,, ico A I Ii) k c„.„....,, 4111114.,it 1. 1 1- :„..,,...,,, a 3 Ikms "` TOc ef I t 4 ! t T. Ty t4 7--.\--- 48 l'—'''''''''''''— ar' n t O tri 1/4 ., s ,„_, p a o y 0T.--0,4,-'' -1--"' ''•'7-'i. dgo 0 V a mow.} N N P.N i 00 a aLL LL HAUN & ASSOCIATES 127 1i TMK:J315-6-001 Por. 082 Report 1516-011819 II Previous Archaeological Research A considerable amount of archaeological research has been conducted within Puakea Ahupua'a, including 11 the entirety of the portion of the ahupua'a seaward of the Akoni Pule Highway. These projects, totaling more than 750 acre are shown in Figure 23 and summarized in Table 2. Not included in the figure or table I are Statewide Survey of Historic Places survey that extended along the west coast of Hawaii Island and the historical overview of the North Kohala district by Tomonari-Tuggle (1988).The sites identified during these projects were subsequently documented during surveys by Bury et al. (2006), Clark et al. (2013), Rosendahl (1982a, 1982b) and are included in those entries. The prior archaeological studies in the area indicate widespread disturbance associated with historic 1 cattle ranching. Despite this disturbance, 60 sites have been documented. This equates to an estimated density of 13 sites per acre. Between 1982 and 1993 a series of field inspections, reconnaissance surveys and excavation projects were conducted of a 440 acre parcel that extends from the shoreline at Honoipu Landing inland to thelbAkoniPuleHighway.These projects were conducted by Barrera (1984, 1992, 1993)and Rosendahl (1982a, 1982b, 1984). These combined projects identified a total of 22 sites comprised predominately of pre- contact to early historic habitation sites, along several agricultural and burial sites. A portion of the historic railroad grade that extends through the area was also documented. Clark and Rechtman (2005) conducted an archaeological inventory survey pf a 215 acre parcel in Puakea and Kukuipahu Ahupua'a.This survey area extended inland from the Bury et al. (2006)/Clark et al. (2013) project area east to the Akoni Pule Highway. Large portions of the area had been mechanically cleared for pasture improvement; however, 13 sites were documented. The sites consisted of a platform, two habitation complexes, a habitation/resource procurement area, a modified outcrop/wind break, a complex comprised of a water tank, a concrete water trough, and two foundations, a concrete survey marker,a cairn and five modified outcrops/alignments aim Bury et al. (2006) conducted an archaeological inventory survey of a 78.5 acre parcel in coastal Puakea, extending from the shoreline at Holana Bay inland to approximately 200 ft. Portions of this area were subsequently examined by Clark et al. (2013). A total of 25 sites have been identified in this area consisting of two survey markers, a portion of the railroad grade that extends through the area, World War II Navy tower installation, eight pre-contact to early historic habitation complexes, three habitationLenclosuresandtwoenclosureremnants,two burial platforms,two alignments, a mound and three cairns. The area immediately to the south of the present by Corbin and Rosendahl (2006). The area was comprised of former Puakea Ranch pasture land that had been previously grubbed. No archaeological sites or features were identified during this project. Based on the archaeological work conducted in the area,the majority of the habitation sites in Puakea are located in the coastal areas.The interior portions, including the present project area are located along the northern fringes of the vast agricultural complex known as the Kohala Field System as defined by Tomonari-Tuggle(1988;see Figure 16). F HAUN &ASSOCIATES 128 L TMK: (3) 5-6-001: Por. 082 Report 1516-011819 Upolu Airport 111°' \ allip.A mt m \ Limukoko Pont V A`- r UmtwaiBay \ V A 1, \ Y dN \ f N.. UPoIu Airport Road-\.. 'y M 9\\ N. iiN N.2\\2 N.C:\ ' 55:- 43 \ IN BOLL q \ 9 \ 4 Honoipu Landing N04-0 N N 7 \\ \ Puakea Paint ip N V OlO V A Barrera(1984,1992.1993) N c--Halana Bay f Rosendahl(1982a 1982b 1984) Akoni Pule Hwy \ Hwy 270) Hlanaula Pont Bury et al.(2006) N.TA 1Clarketal.(2013) GN' - NIK:(3)5-6.001:08 \ O1- Clark and Rechtman(2005) k.,,, ti0 N N O1- 8r: V 4, \ I-- 4-.1Speaal use N.A S,,, J{/ perma area F tPCorbinandRosenda (2006)N\ 4- N IKUKUIpAHUV N N N Kohala Ddch m II S Akoni Pule Hwy Hwy 270) AWALLot Contour Interval=200ft 0 400 300011 Ahupua'a Boundary II 200 0 ron,n Ditch Figure 23.Previous archaeological work HAUN & ASSOCIATES 129 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I Table 2.Previous archaeological work in Puakea Ahupua'a and surrounding areas I Author Ahupua'a StudyType* 1vaticm 1ft Acreage ssittof Historic use Bury et al.(2006),Clark et al. es Puakea and Kukuipahui Archaeological Inventory 0-200 78.4 25 Cattle ranching2013) Survey I Barrera(1984,1922,1993),Field inspection, Rosendhal(1982a,1982b,1984) Puakea and Honoipu Reconnaissance, 0-550 440.0 22 Cattle ranching Excavation Clark and Rechtman(2005) Puakea and Kukuipahui Archaeological Inventory 200-500 215.0 13 Cattle ranchingSurvey ICorbin and Rosendahl(2006) Puakea and Kukuipahui Archaeological Inventory 450-550 24.6 0 Cattle ranchingSurvey Tot 758.0 60 Previous Ethnographic Research I The current landowner, Ms. Christie Cash, has conducted extensive research into the Puakea Ranch and the people who called it home. In an October 24, 2017 letter to the architecture branch of the SHPD requesting permission to reconstruct several structures on the property, Ms. Cash provides insight into I the Kawamoto family who oversaw the operations of the Puakea Ranch for generations, and a general historic of the ranch.According to Ms. Cash: Because these structures no longer exist and only foundations or ruins remain,we mustIrelyontheoralhistoryofMasaandThelmaKawamotowholivedatPuakeaandwere both born at Puakea in the Cowboy House in the 1920's. As children, their mother I worked for the family in the "big house" and Masa described it as a large two-story home with many bedrooms. According to Masa, many big parties and gatherings were held and his mother worked the parties as kitchen help. Masa and Yoshi would hunt I pheasants for the parties and his mother would prepare them. He described this to me when he came to visit Puakea and teach me the history he could. From 1870-1928, descendants and relatives of James Wight of Kohala resided in the 1 home and managed Puakea Planation and Ranch. The home was considered to be a grand estate and many parties and gatherings were hosted at the home, as "The Society" was a very important part of the predominantly British culture of North Kohala ISugar's growers and Mill owners. Prominent Plantation Families of the time including Mrs. & Mrs. H. R. Bryant, Mr. & Mrs. James S. Wight, Mr. Robert Leighton Hind and Mr. Mrs. H.P.Woods were all residences of the estate home from 1870-1940. Beginning in 1928-1932, management of Puakea was controlled Mr. John Hind, who was the president of the Puakea Plantation Company. Beginning in the 1930s, Parker Ranch also took a greater interest and control of Puakea. In 1944, Richard Smart purchased Puakea Ranch from the James Wight Estate where it11hadbeenpartofthevastWightEstateholdingsbeginninginthe1850s. 1 I I HAUN &ASSOCIATES I 30 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 FINDINGS 11.110 Public notices were published in the August 24 and 26 2018 issues of West Hawaii Today newspaper and in the September 2018 edition of the Office of Hawaiian Affairs (OHA) newsletter, Ka Wai Ola, searching for people that were knowledgeable of the project area and its vicinity (Appendix A). No one responded to the public notices. OHA and members of the North Kohala community were contacted in an effort to identify persons with an intimate knowledge of the project area and Puakea Ahupua'a. Ms. Cash recommended that we speak Masa Kawamoto (a former resident of the ranch). David Gomes (a local historian) and Michael Gomes (a local historian). Shane Palacat-Nelson of OHA recommended that we contact Fredrico Cachola(a prominent member and cultural practitioner of North Kohala). Masatsu "Masa" Kawamoto was born on the premises of Puakea Ranch in the Cowboy house in 1922 Figure 24). Unfortunately, Masa is 96 years old and does not remember much of his childhood time at Puakea Ranch. Masa was a Parker Ranch foreman, a rodeo champion, and a member of the 100th Battalion/442' Infantry Regiment during World War II. In November of 2011, Masa Kawamoto was awarded the Congressional Gold Medal for his service during World War II as part of the 100th Battalion/442'Infantry Regiment. His wife, Eunice, brought him to the ranch for an interview on October 30, 2018. She said that whenever she drives him by the ranch he would point out that he used to ride horses there. When asked if he could recall any traditional practices on the ranch he was unresponsive. Eunice, though, recalled that before the land in the area was sold off the families would farm and grow their own produce; people would hunt birds as well but none of that has happened in the area since all of the families moved out. Eunice also mentioned that while Masa may not remember much he did have a chance to speak with Ms. Cash a few years ago and was able to pass his story along to her then. Christie did share that Masa was born and spent his early years at Puakea Ranch. Masa and his brother Yoshi would help their mother when she would work up at the"big house." I Figure 24.Masatsu Kawamoto at Puakea in the home he was born in(courtesy of Christie Cash, taken 30 Oct 2018) HAUN &ASSOCIATES 131 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 David Gomes is a local historian and luthier currently residing in Hawi. He was happy to have the chance to speak about Puakea Ranch and Ahupua'a but said that his brother, Michael Gomes,was a better source of information. Michael Gomes is a lifelong resident of Kohala and a local historian. He co-authored the book Kohala Aina a History of North Kohala with Sophia V. Schweitzer. Mr. Gomes was interviewed via phone on December 6, 2018. Mr. Gomes discussed Puakea Ranch during the tenure of James Wight and his family as owners and then being eventually sold off to Parker Ranch in the mid-1940s. Dr. James Wight owned land that stretched from Halawa to Mahukona. Dr. Wight built the first animal-powered sugar mill in Kohala to process the sugar from his sugar plantation. Mr. Gomes stated that sugar did not grow well at Puakea Ranch even though Wight used the area to process the sugar from the leeward side of Kohala. Pineapple did grow well in leeward Kohala and was cultivated in the vicinity of Puakea Ranch. When asked he was aware of any traditional cultural practices or places within Puakea Ranch or its vicinity Mr. Gomes stated that the only activities that he could think of were associated with ranching since the Puakea Ranch area has been ranch land for the past 70 years. Fedrico Keakaokalani Cachola, Jr. was born and raised in Kohala and has spent his life devoted to 1 enriching the lives of Hawai'i's youth. He was a teacher at Wai'anae Intermediate, vice principal at Nanakuli High School and principal of Nanaikapono Elementary on O'ahu. He is a cultural practitioner and well respected for his knowledge of Kohala. He was contacted via email in October regarding this project. He was willing to share his mana'o (thoughts) on the project and requested more information on the scope of this CIA. Mr. Cachola did not respond to further contact after further project details were provided. No traditional properties or ongoing practices were identified during this CIA. Parker Ranch leased the property in the 1920's and bought it in the mid-1940s. The local families that lived and worked on the ranch would farm to raise their own produce or hunt birds in the area. These activities have not taken place since the ranch families moved away once Parker Ranch sold its holdings in Puakea. 1 I HAUN &ASSOCIATES 132 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 CONCLUSION The objective of this CIA is to identify any culturally significant resources or traditional cultural practices that occurred within the project area and its immediate vicinity. The CIA was conducted following the framework set forth by the Hawaii Supreme Court in the case of Ka Pa'akai 0 Ka 'Aina vs. the Hawai'i State Land Use Commission(LUC). This CIA was prepared in conjunction with a Special Use Permit application for the County of Hawai'i Planning and Building Departments. The landowner proposes to operate the 14.92 acres special use permit area of Puakea Ranch as a "Guest Ranch." An archaeological inventory survey (AIS) of a 2.14 acre portion of the property was conducted in October 2018 and identified three historic features of a previously identified site (Site 9071) within the project area,two historic concrete slabs and a ranch wall (Haun and Henry 2018). The portion of Site 9071 within the project area has retained its integrity. It was assessed as significant for its associations with sugar cane cultivation and cattle ranching which are activities that contributed to the broad patterns of history(NRHP I Criterion A). Site 9071 is also associated with Dr.James White(NRHP Criterion B), is an excellent site type example (NRHP Criterion C) and has the potential to yield information which may broaden our understanding of the local history(NRHP Criterion D). I Previous ethnographic research showed that sugar and ranching were the prominent economic activities for this area. The early 20th Century showed a shift from sugar cultivation to ranching at Puakea Ranch. There was not enough water to make sugar cane cultivation lucrative. Parker Ranch began leasing Puakea Ranch and its surrounding lands in the 1920s and bought the lands in the mid-1940s. Masa Kawamoto, born and raised at Puakea Ranch, a cowboy and World War II veteran, and his wife, I Eunice, once recalled farming and bird hunting activities taking place in and around Puakea Ranch. Michael Gomes, a local historian and author, noted that the only activities he could recall for Puakea Ranch were all associated with ranching. Once Parker Ranch sold its Puakea holdings the families that lived on and around the ranch were asked to leave and those activities no longer take place at Puakea Ranch. No traditional cultural properties or practices were identified within the project area during this study. Traditional cultural practices and properties may be present in Puakea Ahupua'a, but the proposed use of the ranch should not interfere or have a negative impact upon them. I I HAUN & ASSOCIATES 133 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 REFERENCES Archives Division of the Hawai'i Department of Accounting and General Services. 2017 http://ags.hawaii.gov/survey/map-search II Beamer, Kamanamaikalani 2014 No Mokou Ka Mana Liberating a Nation. Kamehameha Publishing 2014, Honolulu, HI. 111 Best,G.M. 1978 Railroads of Hawaii: Narrow and Standard Gauge Common Carriers. San Marino, CA. Golden West Books. CA:Golden West Books. Bushnell,0.A. 1993 The Gifts of Civilization: Germs and Genocide in Hawaii. University of Hawaii Press, Honolulu. Chinen,J. 1958 The Great Mahele:Hawaii's Land Division of 1848. University of Hawaii Press, Honolulu. Conde,J. 1971 Narrow Gauge in a Kingdom.Glenwood Publishers, Felton,California. Coulter,J. 1971 Agricultural Land-Use Planning in the Territory of Hawaii 1940. Agricultural Extension Bulletin No. 36 Honolulu. DLNR(Department of Land and Natural Resources) 2003 Hawai'i Administrative Rules, Title 13, Department of Land and Natural Resources, Subtitle 13,State Historic Preservation Division Rules. Day,A.G. 1992 Hawaii and Points South:True Island Tales. Mutual Publishing, Honolulu. Dye,T. 2017 Archaeological Reconnaissance for a portion of a Proposed Heritage Sugarcane Plantation, Land of Kealahewa, North Kohala, Hawai'i Island,TMK: (3)5-5-006:010.T.S. Dye&Colleagues report prepared for Company Rum LLC. Ellis,W. 1963 A Narrative of a Tour through Hawaii. Originally published in 1917. Honolulu Advertiser Publishing Co., Honolulu. FR n.d. Foreign Register of Kuleana Claims Recorded by the Board of Commissioners to Quiet Land Titles in the Hawaiian Islands. Manuscript. Hawai'i State Archives. a HAUN &ASSOCIATES 134 1 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 FT 1 n.d. Foreign Testimony Recorded by the Board of Commissioners to Quiet Land Titles in the Hawaiian Islands. Manuscript. Hawai'i State Archives. Giambelluca,T.W.,Q.Chen,A.G. Frazier,l.P. Price,Y.-L.Chen, P.-S. Chu,J.K. Eischeid,and D.M. Delparte 2013 Online Rainfall Atlas of Hawai'i. Bull. Amer. Meteor. Soc. 94, 313-316, doi: 10.1175/BAMS-D- 1 11-00228.1. Indices 1 1929 Indices of Awards Made by the Board of Land Commissioners to Quiet Land Titles in the Hawaiian Islands.Territory of Hawai'i, Honolulu. 111Kuykendall, R.and Day,A.G. 1976 Hawaii:A History from Polynesian Kingdom to American State. Prentice-Hall, Englewood. NR n.d. Native Register of Kuleana Claims Recorded by the Board of Commissioners to Quiet Land Titles in the Hawaiian Islands. Manuscript. Hawai'i State Archives. NT n.d. Native Testimony Recorded by the Board of Commissioners to Quiet Land Titles in the I Hawaiian Islands. Manuscript. Hawai'i State Archives. Oliver D. 1961 The Pacific Islands. University of Hawaii Press, Honolulu. Pukui, M.K.,S.H. Elbert, E.T. Mookini 1976 Place Names of Hawaii, Revised and Expanded Edition. University of Hawaii Press, Honolulu. Rechtman, R.and M.Orr g 1998 Archaeological Inventory Survey for the Upolu Airport Master Plan, and Environmental Study, Lands of Kealahewa 1, 2 and 3 and Opihipau, North Kohala District, Island of Hawai`i. PHRI report 1764 prepared for Belt Collins Hawaii. Sato, H.H.,W. Ikeda, R. Paeth, R.Smythe,and M.Takehiro,Jr. 1973 Soil Survey of the Island of Hawaii,State of Hawaii. U.S. Department of Agriculture,Soil 1 Conservation Service and University of Hawaii Agricultural Experiment Station.Washington, D.C.:Government Printing Office. Schmitt, R. 1977 Historical Statistics of Hawaii. Honolulu: University of Hawaii Press. Schweitzer,S. 2003 Kohala Aina A History of North Kohala. Mutual Publishing, Honolulu. NO HAUN & ASSOCIATES 35 1 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 I Stephenson, L.K. L 1977 Kohala Keia (This is Kohala)Collected Expressions of a Community,A Product of Kohala People. Privately published. The Hawaiian University of Hawaii at Manoa online library L2018 http://magis.manoa.hawaii.edu Tomonari-Tuggle, M.J. V 1988 North Kohala:Perceptions of a Changing Community.A Cultural Resource Management Study. Prepared for Hawaii State Department of Land and Natural Resources—Division of State parks,Outdoor Recreation and Historic Sites. Ulukau: The Hawaiian Electronic Dictionary, A Dictionary of the Hawaiian Language (revised by Henry H. Parker). iib 2018 http://ulukau.org U.S.Climate Data website L2018 http://www.usclimatedata.com) Waihona'Aina Corporation r 2000 The Mahele Database,waihona.com. Wehewehe.org lib 2016 Hawaii Electronic Library -Nd Puke Wehewehe 'Olelo Hawai'i Wolfe, E.,and J. Morris 2001 Geological Map of the Island of Hawaii. U.S. Department of the Interior. U.S GeologicalOil Survey. I r, it L I HAUN &ASSOCIATES 136 16 1 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 1 APPENDIX A: LAND COMMISSION AWARDS IN PUAKEA AHUPUA'A (FROM WAIHONA `AINA) 1 1 . 1 1 1 1 1 1 i I 1 1 1 HAUN & ASSOCIATES 137 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 Claim Number: 08746 I Claimant Keawe Other claimant: Other name: I Island: Hawaii District: Kohala, North Ahupuaa Puakeaiki,Puakeanui I Ili: Puuoneo,Puulaula, Kalipahale. Paehala. Haliipalala, Laleakone IApana: 7 Awarded: 0 Loi: FR: I Plus: NR: 34v8 Mala Taro: FT: 77v4 Kula: NT: 121v4 I House lot: 1 RP: KihapailPakanu:6 Number of Royal Patents: Salt lands: Koele/Poalima: No I Wauke: Loko: No Olona: Lokoia: No I Noni: Fishing Rights: No Hala: Sea/Shore/Dunes: No Sweet Potatoes: AuwailDitch: No I Irish Potatoes: Other Edifice: No Bananas:Spring/Well:No Breadfruit: Pigpen: No Coconut: Road/Path: Yes Coffee: Burial/Graveyard: No I Oranges:WaHlFence:No Bitter Melon/Gourd: Stream/MuliwailRiver: No Sugar Cane: Pali:No ITobacco: Disease: No p I I I HAUN & ASSOCIATES I 38 II TMK: (3) 5-6-001: Por. 082 Report 1516-011819 KoafKou Trees: Claimant Died No Other Plants: Other Tree. Other Mammals:No Miscellaneous: 3 No.8746,Keawe,January 14, 1848 N.R.34v8 Puakea is the Ahupua'a claim. It was from Keohokalole to Kekuanui,from Kekuanui to me,Keawe.Il have held ft'for fifteen years,that is my claim for land KEAWE F.T. 77v4 No.8746.Keawe Kaahue sworn,testifies that claimant occupies one piece of land in Ili of Puuoneo,Ahupuaa Puakeaiki, thus bounded: South by waste land West by waste land North by public highway Fast by Ili of Puulaula. Also one ICA In Ill of Puulaula,Ahupuaa aforesaid. South by land held by Kailiahi West by waste land North by waste land&public highway East by Ahupuaa Honoipu. Also one piece in Ili of Kalepahale,same Ahupuaa. South by land held by Kauiho West by land held by Kailiahi North&East by waste land. Also one piece in Ili of Paehala,same Ahupuaa. South by land held by Keawekipi West by land held by Paahao North&East by waste land. Also one lot in Ili of Ilaliipalala.same Ahupuaa. South by land held by Keawekipi West by land held by Kupihi North&Fast by waste land. Also lot no.2 in Ili of Puuonco,bounded: South,West, North, East by waste land.ay. All the above-descried lots consist of dry land,partly cultivated,unfenced&no houses on premises. Also one lot consist of one equal half of an enclosure belonging to claimant. Keohokalole,situated in Ili of Laleakone,Ahupuaa Puakeanui Said enclosure is surrounded by public,i.e.made land belonging to Keohokalole. Kehuanui(konohiki)gave the above lands to claimant A.D. 1833. Kalarriailalo, sworn,affirms as above. N.T. 121-122v4 No.8746,Keawe,October 4, 1848 Kaaua,sworn and stated, I have seen in the ili land of Puakeaiki ahupuaa,6 sections. 1.Section I-Puuoneo Ili. Mauka by idle land Kohalawaho by idle land HAUN & ASSOCIATES I 39 I TMK: (3)5-6-001: Por. 082 Report 1516-011819 I IMakai by street Hamakua by Puulaula Ili. It has been cultivated;there is no house. I 2.Section II-Puulaula Ili. Mauka bt Kailiahi's land Kohalawaho by idle land Makai by a street and idle land I Hamakua by Honoipu ahupuaa. Cultivation has been done;there is no house 3. Section III-Kalipahale Ili. I Mauka by Kauiho's land Kohalawaho by Kailiahrs land Makai by idle land Hamakua by idle land. I This has been cultivated;no house. 4.Section IV-Paehala Ili. Mauka by Keawekipi's land I Kohalawaho by Paahao's land Makai by idle land Hamakua by idle land. Cultivated has been done;no house. I 5.Section V-Haliipalala Ili. Mauka by Keawekipis land Kohalawaho by Kupihi's land Makai by idle land I Hamakua by idle land. A portion of it has been cultivated;no house. 6. Section VI-Puuoneo Ili land. I Mauka by idle land The rest of the boundaries are Idle land Some of it have been cultivated. 7.Section VII-Ili land in Laleakone ahupuaa named Puakeanui. Mauka and the rest of the boundaries are Keohokalote's land,Two houses are there,one of which is for Keawe,one for Kaaua and another house is for Keohokalole in his/Keawe7!claim IKekuanui had given him his interest in 1833, no one has objected. Kalamailalo,sworn and stated. I have known[I eft blank][as]Kaaua has related here. I No.8746 not awarded] II I I I HAUN &ASSOCIATES I 40 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 Claim Number. 088796 Claimant:Kamalamailalo Other dalmant: Kaulemamoku,father Other name: Island. Hawaii District: Kohala,North Ahuouaa:Puakea Kaawikiwiki,Puumanu,Lelekoae,Maliu Apana:4 Awarded: 1 FR: Plus, NR: Mala Taro: FT: Kula: NT118v4 airHouselot: 1 Kitiapoi/Paluariu: 4 Number of Royal Patents: Salt lands: KoelefPualinia: No Wauke: Loko: No Olona: Lokoia:: No Noni: Fishing Rights: No Sea/Shore/Dunes, No Sweet Potatoes: AuwailDiteh. No Irish Potatoes: Other Edifice:No Bananas: Spring/VVell- No Brexalfruit, Pigpen No Coconut. Road/Path: No Coffee Burial/Graveyard: No Oranges: WalL'Fence- No Bitter Melon/Gourd: Strearnikkiliwai/River.No Sugar Cane: Pali No Tobacco: Disease: No Kaa/Kou Trees Claimant Died: No Other Plants: Other ftees- Other Mammals: No Miscellaneous: Awarded 1 apana,also 1028 dead claim.5 houses No.8879B,Kamalamailalo FT 107v4 Kaaua,sworn,testifies that claimant occupies six lots of land in the Ahripliaa of Puakea,thus situated& bounded- 1st lot-in Ill of Kaaikiwiki.111SouthbyLandheldbyMoku West by land held by Makuahine North by land held by Kikau East by land held by Keaulumoku. 2d lot in Ili of P:rumanu South by land held by Kaaloa West&East by land held by Keauluoku North by land held by Moku. 3d lot in Ili of Lelekoae(no.1) araSouthbylandheldbyMoku West by land held by Kikau North by land held by Keuweopata East by land hold by Makushine, 4th lot I, li of Maliu. South East by land held by Moku West by land held by Kanoena North by land held by Kaloa. HAUN & ASSOCIATES I 4 1 TMK: (3) 5-6-001: Por. 082 Report 1516-011819 rr 5th lot in Ili of Lelekoac(No.2) South by land held by Makaokaia West by land held by Makuahine North by land held by Moku East by land held by Kamikana. Said lots are dry land,cultivated in part,unfenced. 6th 101 in Ili Lelekoae(No.3)occupied as a house lot.It is fenced with wall. Five houses stand upon the premises,belonging to claimant&family. I itle extends back to reign of Karneharneha I through parents of claimant.Uncontested. Moku,sworn,testifies as above. N.T. 118-120v4 No.8879B, Kamalamailalo,October 5, 1848 No. 102B,(Dead claim) Kaaua,sworn,and stated: I have seen there are in the Puakea ahupuaa in Kohala,Hawaii. 1.Section I-Kaawikiwiki Ili. Mauka by Moku's land Kohalawaho by Makuahine's land Makai by Kikau's land 111 Hamakua by Keaulumoku's land. This section has been cultivated and there is no house. 2. Section II-Puurr anu Ili. Mauka by Koloa's land Kohalawaho by Keaulumoku's lard Makai by Moku's land Hamakua by Keaulumoku's land. It has been cultivated and there is no house. 3. Section III-Lelekoae Ili. Mauka by Moku's land Kohalawaho by Kikau's land OPI Makai by Keaweopala's land Harnakua by Makuahine's land, It has been cultivated,there is no house. 4. Section IV-Maliu Ili. IP Mauka by Moku's land Kohalawaho by Kanoena's land Makai by Kaloa's land Hamakua by Moku's land. It has been cultivated there is nn house The house-lot section is in the ili land of Leleakoac.It has a fence and there are 5 houses.3 of which are for him IKalamailalof and 2 for Kaulemamoku,who is his father This had been acquired by his parents during the time of Kamehameha I;no one has objected. Moku,sworn and stated.I have known[Left blank][as]Kaana has related here. Award 88788;Leleakoae Puakea nui N.Kohala: 1 ap.;4.3 Acs;No.1028 not awarded] I I HAUN &ASSOCIATES 142 I TMK: (3) 5-6-001: Por. 082 Report 1516-011819 APPENDIX B - WEST HAWAII TODAY AND KA WAI OLA PUBLIC NOTICES a HAUN &ASSOCIATES 143 1 N. TMK: (3) 5-6-001: Por. 082 Report 1516-011819 AFFIDAVIT OF PUBLICATION IN THE MATER OF PUBLIC NOTICE 1 1 STATE OF HAWAII I 1 SS. City and Comityof Honolulu 1 AUG 2 7 2018Doc.Date: Pages: 1 PUBLICNOTICE Haw&Associates 0 051 an a Wheat iron! Notary Name:COLLEEN E.SORANAKA FirstJudicialCircuit assessment (C(A) for a portion of IME (3)0 ii 001:Por.082 situated in Pasta AhaPuals hi, Doc.Description: Affidavit of x4 E:SO,?kohata District island of Harrell 11re CIA is Cu prepared in conjunction eith Special Use Per' Publication T•'''.. **-:.4”- apeheaeee to operate Puakea Ranch as a"L, Renaloffering antirittes end events to guests:141 -1 NOTARY "-1-'- p- local conwrismin.AR persons haring interment:a , PUBLIC : tradirtronal cutturai practices, resources and pinLef,e ------2-AUG 2 7 2018 *:located within Poakea Ahaptia'a andthe&Myr.,f 7 project Dame) are hereto requested to corni. NotarSture nate 1. No.90-263 •. .7 Selman Kailthiwn,Harp 8 its:sedates,734101 IQigna i y 7 Mate.KadinKona,MI 96740.t808)3252452 poi arty(30)days of this nonce. lelPti‘ 1,,,s WHTII25777 8/24.8v26/18) Gwyn Pang being duly swan,deposes and says that she is aclerk,duly authomedito . execute this affidavit of Oahu Publications,Inc publisher ofThe Honolulu Star-Advertiser,MidWeek,The Garden Island.West Hawaii Today.and Hawaii Tribune-Herald.that said newspapers are newspapers ofgeneral circulation in the State ofHawaii,and that the attached notice is true notice as was published in the IHonolulu Star-Advertiser 0 tittles on: MidWeek 0 timeson: IThe Garden Island 0 timeson: Hawaii Tribune-herald 0 tiineson: I/ West Hawaii Today 2 times on: 08/24,08/2612018 Other Publications: 0 times on: iAnd that affiant is not a party tear in any way interested in die above entitled matter c.‹...............,--r.1 ,ta-7,-- Cr/es....s.e2r. Gwyn Pang 1/4—/ 8/ 11/ Su ribed NOTARY \ and we inn this ?)day of aks.54.:4•tA I)20 * PUBLIC : No.90-263 E... I Colleen E Soranaka.Notary Public ofthe FirstJudicial Circuit.State of Hawaii 1/45%\..'•••........•••:-A,:'42t-My commisscommissionnnssion capons Jan 06 2020 Ad# 0001125777 5 OF SP.NO.: 1.N HAUN &ASSOCIATES I 44 3 ITMK:(3) 5-6-001: Por. 082 Report 1516-011819 Kepakemapa(September)2018 I 111IREip ,__ ti41,,,,,, i tA 1 wvnv ahe-orglkwo poke chainkek, i4Ick 4 I ative Hawaiian fit,, 5, sh for restricting 111vv the use of aloha c, \ a\c1.1,kr m i PAGE 14 n r RBI IC NOTICE s ortiaun& Avaiaeesiseia e1inga i, a otFN `"?adarcal intpanassessment(C1Alft aprxixn T?NK:1315b1Mi1:Pcr. 062 situated m Puakea rLupua'a. 1;II gnuA Borth Knha4t Uetnci, Islam of y„..: Narvai'i.'ttr CIA i.hcing ptepored 1 Y is conjunrtarn w,th Special Use a., ii-Penne a Iwanon toopeale Punkiea '-; Ranch a a Yauest Rant d1ering i^acaciue.and event t guests ud die Meal communiH Al)mons z,' l hninfinfc cacontrthtnmalal- r anal l ri tis .reuxurcry ani placessa ' hrrk wtdon Puakce A}wgta'a ani flt I HfGIS PafelYs the tiamp of the Pert parcel are tgV6tC?r6da'6r's J'' _ s .., herchy teyueued to c ntai Sob* wihc';pa'i' rsti, nrrn Knililuwa,Haan&Aaniiatea. 73.d16)KaaczPlate.l:ailu'a lSztna.Hl A-,.. (, >',=t y^` 967-011.I$)41 3_i_2(t2 widmt!himiVz2tr fi r dt dry.of du,mAh.illfi%.. 4,400,.......... HAUN & ASSOCIATES 145 i SPECIAL PERMIT PUAKEA GUEST RANCH 1 1 TMK: (3rd) 5-6-001:082 Puakea, North Kohala District, Hawai`i Island, State of Hawai`i I Appendix 4 Traffic Assessment Report 1 I I Traffic Assessment Report for Puakea Guest Ranch I I Puakea, North Kohala District, Hawaii County TMK: (3)5-6-001 :082 I 41' LK:MUSED la 1 o pro. a r 134632 0® 9203 44.94011 e 1 1 This work was prepared by me or under my supervision and construction of this project ill be under y e •servation. I JAM S M. ' DERSEN P.E. Expires: 04/30/2020 NOVEMBER 18, 2019 a a JPE CIVIL AND ENVIRONMENTAL ENGINEERING POBOX 551751 Kapa'au HI 96755 808-854-4888 INTRODUCTION: This report summarizes the findings of a traffic assessment for the proposed Puakea Guest Ranch. This Traffic Assessment generally describes the anticipated impact to traffic based upon when the project is completed. Comments provided by the Hawaii State Department of Transportation dated January 7, 2019 and October 9, 2019 were reviewed and incorporated into this report. PROJECT DESCRIPTION: The owners are requesting a Special Permit for use as a Guest Ranch, which would continue vacation rentals and provide facilities that would allow for various functions including weddings and community events. The project involves the adaptation of existing Puakea Ranch structures, four of which are currently used as vacation rentals, and construction ofnew ones, to develop a Guest Ranch. The Guest Ranch would be able to accommodate as many as 38 guests in the seven rental units and event area, an increase from the current limit of 18. It would host group activities such as weddings and family reunions, which would be accommodated in the new event area. A maximum number of persons on property at any given time for private guest events will be limited to 100 additional non-guests. Events with more than 38 attendees will be limited to 9am - 8pm, (Sunday - Thursday), 9am-1Opm Friday, Saturday). Obtaining the Special Permit would allow the Guest Ranch to offer activities, opportunities and events to guests, local schools, community and seniors groups to experience ranch life and learn about the history of the surrounding area,plantation life,the Paniolo, Japanese and native Hawaiian cultures that make North Kohala what it is today. The Puakea Guest Ranch would like to host up to two community events annually that will allow up to 350 guests. For these one-day community events, event hours will be limited to 9am-9pm (Sunday), 9am-1Opm (Friday and Saturday). The Puakea Guest Ranch is located in North Kohala on Hawai'i Island, approximately two miles before Hawi Town, Tax Map Key (TMK) (3) 5-6-001:082 (see Figure 1). The 32.4 acre parcel is approximately 1.4 miles inland from the coast, immediately mauka of Akoni Pule Highway, State Route 270. There is one proposed access point to the parcel off the mauka side ofAkoni Pule Highway. It is an existing paved driveway near the 18 mile marker. EXISTING TRAFFIC CONDITIONS: Akoni Pule Highway, State Route 270, is a facility under the control of the Hawai'i State Department of Transportation(HDOT). It provides access to Kawaihae Harbor and also serves as the belt road to Hawi town. It is classified as a Rural Minor Arterial. It is a two-lane undivided State highway with 12' wide lanes and paved shoulders. The posted speed limit along the main stretch of this roadway is 55 1 1 1 miles per hour(mph)with a gradual decline to 25 mph near towns. The posted speed limit at the entrance to the project site is currently 55 mph, although there has been a proposed reduction to 45 mph for this area. Directional traffic is generally symmetric for this area of Route 270. The existing traffic volume data is published by the HDOT as an Annual Average Daily Traffic Count, or AADT,which is a measure of the average number of cars that travel on that section ofroadway in a given day. HDOT gathers AADT through a combination of permanent, in-ground traffic counting stations, overhead cameras, and temporary traffic counters or tubes. The 2017 HDOT data for this stretch ofAkoni Pule Highway shows an AADT of 3,100 (see Figure 2). HDOT has not published Future Baseline Traffic Reports for Akoni Pule Highway. Regardless, it is expected to remain as a minor arterial with minimal increase in use. The North Kohala District has recently seen relatively minor growth rates around 1.05%. Most of that growth activity has been, and is predicted to be, located south of this project site. The access to Puakea Bay Ranch subdivision is on the west side of the same intersection. There are no traffic controls at this intersection. Traffic to and within Puakea Bay Ranch subdivision is extremely low and does not present traffic congestion problems. Puakea Bay Ranch is comprised of 42 parcels. Currently there are less than twenty homes in the development. The gatehouse at the entrance is manned seven days a week with 24 hour key code access for the owners. The Puakea Ranch access includes an easement to allow for shared access to the two parcels mauka of the project site. Currently those two lots are undeveloped, traffic is accordingly insignificant. 1 PROJECT TRAFFIC: The proposed project will generate an increase in vehicle traffic on Akoni Pule Highway once the Guest Ranch is in operation.Access to the project site is on the mauka side of Akoni Pule Highway approximately 0.1 mile past the 18 mile marker. Puakea Ranch currently employs a crew of eight part time staff,two full time salary employees and pulls from local outside contractors as needed. When the Guest Ranch is operating an additional five employees are anticipated. Typical work hours are between and would continue to be between 8:00am and 4:00pm. The increase in daily round trips is expected to be 10 round trips per day representing less than 1% of the current traffic load on Akoni Pule Highway. The guest traffic is more generalized. For current rentals, Puakea Ranch typically sees one vehicle per each of the four rental units. These guests may leave once or twice a day. With the increase to seven units,the guest traffic is expected to approximately increase by five round trips per day.Again, representing less than 1% of the current traffic load on Akoni Pule Highway. Hosted events represent a more significant impact. For a typical guest event, Puakea Ranch anticipates approximately five vendor vehicles in and out along with an additional 20-25 vehicles for attendees. Event traffic is typically focused around sunset hours, approximated to be between 4:00pm and 9:45pm. Event guests usually car-pool and/or organize shuttles. This practice will be encouraged. The 30 round trips for that day of the event still represent less than 1% of the current traffic load on Akoni Pule Highway. The large community events represent the greatest expected impact. These one-day events are to be limited to only one or two per year. The owner plans to coordinate with traffic services in order to ensure the free flow of vehicles through the project entrance. An event like this is expected to host up to 2 r' I I eight vendor vehicles and approximately 88 attendee vehicles. These round trips focused on only one or two days per year only represent 3.5% of the current traffic load on Akoni Pule Highway. The typical trigger for preparing a Traffic Impact Report(TIR), contained in the HDOT Best Practices Ifor Traffic Impact Reports, is 100 or more new peak hour trips or 500 daily trips. The relatively minor increase due to this project does not register that trigger and is therefore not expected to cause a significant impact. i ACCESS TO AKONI PULE HIGHWAY: IThe existing driveway appears adequate to serve the proposed project. According to HDOT records, the paved driveway is the original constructed in 1972 and is 18'wide. It is fully paved the approximately I100'through the property line and has tapered radii extending both directions. HDOT Highways Hawaii District Engineer will be consulted regarding any improvements to the access Akoni Pule Highway,Route 270. No parking will be allowed along Route 270.Ito This stretch of highway is relatively wide open with well maintained mowed grass beyond the shoulders. Site distances are easily pushing 1000' in both directions. The owner has expressed interest I in installing a STOP line to encourage guests leaving the property to fully stop prior to approaching the highway access.No parking is allowed along Route 270. There is a potential for project-induced secondary effects on Route 270 traffic safety during hostedIevents. If traffic issues attributable to the site operations are identified,the owners will mitigate the impact to the satisfaction ofHDOT,Hawaii District Engineer.A permit to perform work upon state I highways will be submitted for any work within the highway right-of-way. CONCLUSION: IProject related traffic is not expected to have any significant impacts to Akoni Pule Highway due to the low volume of employees and guests that would access the site. HDOT Highways Hawaii District IEngineer will be consulted regarding any improvements to the existing access to Route 270. REFERENCES: I Hawai`i Department of Transportation, Hawaii Department of Transportation Best Practices for Traffic Impact Reports, May 2011. 1 Hawai`i Department of Transportation, Hawaii Department of Transportation Highways Program Status, 2017, (histategis.maps.arcgis.com). IThe Institute of Transportation Engineers, Trip Generation Manual, 9th Edition, 2012. Hawai`i Department of Transportation, Hawaii Department of Transportation Guidelines for Project- Level Traffic Forecasting , December 2015. ICounty of Hawai'i, Department of Finance, Real Property Tax Division, 2018. County of Hawai'i, Planning Department, General Plan, 2005. IBelt Collins &Associates, Final Environmental Assessment, 1993-05-08-HA-FEA-Puakea-Bay-Ranch- Passive-Park, 1993. I3 I e 1 A*t PAFtkAt A Li'''. TMSit„,,„ P'' A....iir - -„,r r 0 1 „ 5.- Ls w ry 3 i , e 70 A. F yp41kPt Xtgir V imiblik.„lullitv7741111111111P".* 41' Mil --- '''' K. f' ti 0 6000ft lidourimmtI11111111111111111111111 simeneinoiniiimmul 209441,1 1 r FIGURE 1: VICINITY MAP I I 4 I iHDOT Hk.11,Nays Program Status f V, U•a> 4' INIoI road I i 4Q--------_,,_\ irafrk-Count2017 TraffIcCountData2017_ExcelToEve10 0175000 I R €2' 507441(18)0 0)250003., Annual Arge DatlyiniffiC AAADT iii:COUM 3 55000 i x x 4 i, i 1 — FIGURE 2: HDOT TRAFFIC COUNT 1 I I I I I I I I I5 I Puakea Guest Ranch Special Permit this page intentionally left blank] 1 1 1 1 I i i I 1 I SPECIAL PERMIT PUAKEA GUEST RANCH 1 I TMK: (3rd) 5-6-001:082 Puakea, North Kohala District, Hawai`i Island, State of Hawai`i I 1 Appendix 5 Letters of Support 1 I I I I February 18, 2019 Dear Mayor Kim, IWe, the undersigned residents and merchants of Kohala, are writing to urge you to award Puakea Ranch the Special Use Permit needed to operate the ranch, not only as a vacation guest ranch, but also as an event venue. The ranch is an integral asset to our community since 2008. The overnight guests at the ranch frequent our local establishments, which in turn I brings economic stability to our community. In addition, the ranch has the capability to bring a unique venue to our community that will offer many much- 1 needed opportunities for North Kohala. The owner, Christie Cash, has a daily presence on the Ranch and is an active member of the community. Christie has built trusting and meaningful relationships with the local schools, the senior center, the North Kohala Community Resource Center (NKCRC), as well as many of the businesses in 111 town. The rich history of Puakea Ranch has been preserved with each and every step Ms. Cash has taken in the careful restoration of the property. Many local families have helped to share their knowledge of days gone by on the Ranch and are grateful for the work she has done. She has restored it to a place Kohala can continue to be proud of. If given the Special Use Permit, the community of North Kohala will have a local venue to hold weddings, birthday parties, fundraising dinners for the Kohala Hospital and the NKCRC, grad nights to keep our keiki safe, and much more. Ms. Cash has been extremely generous in supplying complimentary overnight accommodations for fundraising efforts and will be able to continue that generosity with expanded opportunities on the Ranch. Through a front-page article in West Hawaii Today on January 17, 2019, we became aware of a lawsuit and mounting fines levied on the Ranch. We are very concerned that our community will lose this valuable asset, many local jobs, and a good neighbor if these matters are not resolved quickly and with minimal financial impact on the Ranch. The Ranch is not sustainable without the Special Use Permit. We are certain that Ms. Cash is willing to compromise on noise- hour limitations and event frequency for any one who might have concerns. Mayor Kim, this is an amazing opportunity for the community of North Kohala, and it results from the hard work and perseverance of Ms. Cash. Please do not let it falter. We urge you to expedite the Special Use Permit for Puakea Ranch so that North Kohala will have this lovely venue available for its residents, IMO and visitors can come to experience the wonderful place that we call home. vie I I Petition to Award Puakea Ranch A Special Use Permit 1 Business in North Kohala hinftAName 0 4.a c /C.t--1i RCCC rePdtr 'rate/Cl/12 t 4 1 i.. c Pka C .'7.4. 73 CI/5;Pet it/1 1 LCC k?"63 kj"' A/ I s Ible riiet16 fif.A. Cbca l/ iisrAl ` • • Amity Br8 T5 1mfr-r, - "ono44x, :::1,..„1--e.. r111 .;,; o 51 di°j 11°° IL..,at° lad 1 ..._ 3 ttSil"1/4) /A je. . S t I iOiMINIVIIIIIIMMIERNM* ia. II,ar i iv., 14, 1 x1,1:4 "Iona, er.7b ^fae.l.;h adi,lie 1441,0b 1 di‹ r PA*tele met.€,-i91 I I I I I I I I I I IPetitionto 1 Printed Name i•• Si• • . Town_of Residence I UtaAJ),474.47k 7 / V\-mut 1c/-4/./ 11 c- Yki\ 4 OD. 0 N: 41' 7t ce;,49 e---.e-- t ..s .... ti 041 111 II kc 1Z40(11) itaiNCI I , its- t4 ki e:14\-floc\ us_ I vr.8, ...,51-ii,-if &r-J net(A)k.I 4,0,4cdo-;cei , 13 iz) p1.1 1)GilAiN .hievtLOt. Kar,....0 I koi samit, -711,------ kaixti I I 1-cg--------- 1-ta40 i git.. KLee-- 'dAie /2.4‘,- ‘4Ziezzei Led Sii44- 411,21 I i I e° ;( 4,(ii, I 1 711 po y I‘1, 1 -.' kly),V4() itt I mier, t- clexi -c„ g-it-- If IZ --,354,...___ t eleto_pf I A ' I I I I I Petition to Award Puakea Ranch a Special Use Permit I Printed Name 4 i .TownResidence I Ork 00.Tlirts r lafa. 4(iitve. vichtr 40 .1 I cdtisiii.c rol/4 ilk 4E ;4 4 • 1,1 Aka, Al ;-1 e...,-,dr-. hild , CJS Ahl i a ap "et4.14) I 1 ol , ;et)iv atill ler er 4a-Lili ituftG 71M4S 0 111 4111111Af 1 144Ezici-larAtc, it4A-- m1hiw})11, 0 D,..9n•Ii 19Yra\, mmmr AiN-----------Yottt,t1A- I CIA:4,,,c.4-6 t hrt siN\c R cA ilc,., I F1-4.104 ett.... I I I I I I I I r I I Business in North Kohala nted •ane Signature I ALL ,,. - 1 0 tr, ._. .- III A" ' 4" , CI iV V ApI $trk--, f, 55, r ,c t.--..... oars, p.R11/ ;#1.. ,T kiasec lo. ctc.k... x0; ittok,gAirtc,A,4--:41A I 13tsw iD G+S'1 V S Z44,14 , 0a.--- 7%v1, 10M.V ?- pct(t Fa.vcrk 4f° k 1 C,n4 "J€ C/ 144,"4 n, r 1 0 4%T 5 Oft I, HI ;ll ititlyi 14.,brediik,Sctkvikotit- b.,.. , t f fi`.. ili,44---- .. r I I4f ,,4 i3) (it”' rrr. a ci7f s9 4, T1 tiA,01-tevt t A/141 tfi, thA4 KTCIIc--- 0.-‘,4, 700111rel 1 kkr.,...... I5_, ivoc-40-7 . imar 7cloh 4--- ak--tr-re 4(/-4 , fir a 1.14i Ri Iildie4i R4?liit kailirie ..464.1 1 0 a 1\itr ( 4ç\a, ,. e,,e4Aly ill r4,,,j,02 iiittlitek. iof I I 1 Petition_to AwarttPuakea Ranch a-Special Use Permit Printed Name Signature Town ofResidence Z;1' tie 3 01'410i'1 / n.•. %•14` Q c Mc4u r 1I1tuhuu 3 0 f< s L re I 14- J ; A/19jet724-4 Pal ty Mot1/44tAilivx ericijefdeuv t a i Held; O15oc g}o t (?Crs, t Cx r v 1 I I I I I I I I I I I I Petition to Award Puakea Ranch a Special Use Permit Printed Name Signa 4 Town of Residence I 06164 arah,ffli dp me 16 IMW1 72)k ` div 04,0.-//3. . Amw i Atice.foolr I Olva R3teln f ElenfetlA Prvi friaochtiptfr I 174et1is4., G . Mar ; - ef; i / ii 1-6176.. Uct ILiamthi*r f O.Ppay vi 1 144th iv- 40, , L...1. ..... , TNAtiiii(Aiitif 'Q. I 4 / 'he /fel it(V511 A 7'i egAmAi IkmSeetene. t liarnil nis ai-K 1 titth e.Z.- - 7 c 1 1 aTib I Afi IA /k94' i lid in61 g(tmtr. i 4 I't4W -I I 1‘co,e, .v. sk:\'\,,,,( s IVA ctki•)two I1-6M) I I PoNAL9 rtz4u6 ti-, 60.imi . fiakii. ( 6,,, k p)071) k4v4 filikb , ' Wil I I] 1 di 1 3 I Petition to Award Puakea Ranch a Special Use Permit IPrinted Name Signature Town of Residence I0h e1*S &f.ch..0 0 l'.(& 13A-4, kJ:kr Clettt I 1'1,.,..4.1 C'`- -' k y 24,' tom.r D,4%---- He,L.t,-,- C-'1A-/%--- iec.ii,......,I v.1 ilA cl 1 4-tfall 14 s ell Otr,d4 itcItC.tct, 0orri nlc 1011".6.416.47./Z0 KfaaU VI X44..---' dam--- .....__;. iff.4.--4.0. I GAtegvi rui.x.-N -ececitte_. .er.::$_.-1,„t..-,...,-yr_34,4- 4"kt:AWl I 1 Adr /j1,,//11 , i Ah Q irjhwl Bit/ _i._j i ar.ii arakikiia i cratinqfPrf4y6fai11.4 t`rii._ ' • II! I W.%0424Cl24 S t;Au i,..-- kAte/ CUM- agiu49? C/\_41----- , KAP410 I J--ci. 5)55e k4944v 1/4//sag 494,oco Ve/Aaelez Aer.4r..2.4._,- I R9,6 xt ..5kVA.2 1 b gyp 14:1 -7-7- 7 ii-14,/ I I I I I I I Petition toAward PuakeaRanch a Snelial Use Permit PrintedName Signaturt Town ofResidence I d-hr( f) RialaPg.Ce/l7 CreeeeC20-- 4al•fri Ibea‘///4 tee afd 1 fl-- PAS (e44-14-)61( yi 1 /-- -_.., gn-eNk) 1 vP A--r ki-R›/A2 t.77716€12 e.. _-, itt-e6a-e:Ir2(el ill 0 456.-ail. 4 16 ov-- 14140-L: K,...„' t,ex.\ Tict.ko.-6._ t,N,...-kle 341.c:M. W1413.11 Ra nch I 50P eib li ---\ICIAA.tbr--C- 1 4. 1ffret4A- 1; I ,C) I1-fett ) lowte)41(1ok v f• Juilgie Aig ail- V---LA 4 aul;I rittASSa UirilAZ rr 1 / riff, te74i Rockgey VI rive_ ef,2-- H-ckw;III yiefit'let_ Elion4c Yhivit) ‘A-1.(521 tiatAii I 3 I I il I I I I I Petition to Award Puakea Ranch a.5pec_W Use Permit IPrinted Name Sim.Wig Town of Residence I f,G-4'f/ X-4/4I- g_.----_. I.'.'4''o./ rj' 90 C .. a, j `_-°` p A.4-2,6,".t..4„ Ani C°v a (isa Ile et t ., ‘ M1 :1tUjo f ot.,‘ fikvki1 I kiz it/A* 1 •C MeiriVI IJ b"`'."`4,f ,Y y r ilia Poekri 114710 Mckilk-f. a to iItt l:A. idf tv , /IJ , : atIJO ,I , ‘ f f tor /1 IQ Vet G 4.i. , 10 / R Dane0 4/ 4t i iLi 4 lir 1 1,- irxi 4I trit31:S 4./14041 I Ar ICU1 para ri Kapaa v I I I I I I Petition to Award Puakea Ranch Use_Permit WIi,0 . JO‘,C kr Cki4diAwl4114 t 11kijJ4 , 17(&W CIA t t`y iN y 1 I'. 4 ripQ ail cie) 44 Et;za. t 1 1 i 1 1 I I Petition to Awarci Puakea Ranch a Special Use Permit IPrinted Name Si.„ ure Town of Residence I i 1/k/r..D A iti`h 6 Z,I17: A Al • '1;49 41 i71 I t:-i •:: 4-1^k- t,,e 3 t a,,,,eIIL JIill(CiPt'; U a 61sk.2.7vt, /4 .t. 4/A M 2 pcoecc leAN.-ve, 111AAL Xitlic-il---- ZA.MAJ t1 iIl I I I I I I OA is I I I I I I Petition to Award Puakea Ranch a Special Use Permit Printed Name Signature Town of Residence I RATLI[e •fott.(51-3 l i ; IP , qa.W i I Pot vtej bvaii; C,lie tv.- t‘ie\/1 CSike--- A/e VI ra 5 14414)1 1 71,0E A\'1ZK i 64 An 1 Sy fL\ , ) ChOtr1A-- 1.-ittut-h I h 0 ...a._ jr 71- isermiffitrAor 4 te,*e' Ran ' 1110 I - is litt° 1 I I ; 1 I r.vio I Petition to Award Puakea Ranch a Special Use Permit IPrinted Name Si nature TQwn of Residence I 1 I r'ti_ '' •3spun t----- hi,..e I To,14fl 9 fOcyLl_ 1 __ _ 46 4) 1 CAAW449124, 1.6„.I e 3 g 5 tr7,6')-7,42,---- IAvcc_,, '44 /hs Z_Ye IC< #7 1 1 C- 1,-11/k \\)64., 1115 Adik,• 6/1_4-eefa ta,“.I t i _ 1 14.Airt 1/0 lizrA4tn-A.e.-<._ ` (1 , kk)• Lay. 1 icr I 1N/ tt-. 7h,--..k -4- C tt iii T- N c ic;_ 5-14, ( 77-4 ic-a p 1-11-1-t-t lo --, 4 --1 1 r -44.c___ eL\I rC k G(7r-doc \r( (zke../.1 1 I I v\- t ) 16, \,/ SOntwe vi'l•Q!" a...:4,Av•.(r'1 , k4iciG1/4 Licit\ 47 1)•1V4-)J7 4., i VNekrak-1/4 me I (i ..f71 41L7 II I ir I I I ir 1 Mori, Ashley From: Yee, Michael Sent: Saturday, September 28, 2019 9:50 AM To: Mori,Ashley Cc:Ley, Rachelle Subject: FW: Puakea Ranch Please intake to Jeff I From: Rebecca Keliihoomalu [mailto:rebeccak@elitepacific.com] r "` 41 Sent:Thursday,September 26,2019 6:29 PM a To:Yee, Michael <Michael.Yee@hawaiicounty.gov> m • .... , Cc: Rebecca Hirsch-Keliihoomalu<rebeccak@elitepacific.com> Subject: Puakea Ranch 1: v' ' op I:7. rr Mr. Yee, Resending as it appears there was a glitch in my first email. Mahalo. i Mr. Yee, I I am writing in support of Christie Cash and Puakea Ranch. Additionally I am responding in part to the article in The West Hawaii Today dated 9/23/19. I I have known Ms. Cash since 2005 when she contacted me to help her find a property for her family here on the ' Big Island and to perhaps start a retreat center of some type and begin a new career. Christie had a very solid career at the time on the mainland along with her husband Jay Nelson, yet wanted to find a place where they could remove themselves from the bustle of mainland life and raise their children here on the Big Island. We searched all over the Island and ultimately came across Puakea Ranch. We found Lot 1 by my reaching out to other agents to see if someone had knowledge of a property matching Christie's parameters and agent Jack Larson responded and ultimately introduced us to the property which was not on the market at the time. Jack was representing the owner, Roger Meeker. From the beginning, Jack had full knowledge of what Christie's intentions were and was in full support of her plans to restore the cottages and create a venue for tourists to experience a more eco friendly historic guest ranch and meaningful way to visit our island. He enthusiastically and intelligently participated in many discussions including initially naming the property and contributed many vital ideas to the vision. Upon viewingthe property we found it to be in a shambles, rodent infested, dilapidated, neglected,p subjectp P barely livable, likely unsafe to live in yet people were living there, windows and doors that were boarded up and frankly in disgusting condition. There was no real activity such as farming or plans by owner to improve these structures and we were told being sold AS IS. The tenants for the most part were living in basically slum-like conditions. I recall it was a difficult transaction as finding a lender was challenging due to the lack of permits in County Records which rated the construction "poor" and referred to the old cottages as "framed utility3 sheds". The Ranch had basically been 'abandoned' for years and had recently become 9 lots of record within the new subdivision developed by Roger Meeker. Despite the condition of the property, Christie could see the beauty in the historic components and embraced the plantation era remains. She proceeded to purchase the property in 2006, moved her family here the following year, placed her children in HPA,hired architects,builders, landscapers, lawyers, bought a house in Waimea 3 where they could live while planning out several years ofbudgets and with a conscious 1 64 ,'i , ..• -.l 1 OCT 0 3 201, 1 8_0__5_ 1 Puakea Ranch,proceeded down the very complex and difficult road of doing business in Hawaii and Igetting through the quagmire of the county's rules and regulations. Through sheer will power, good intentions, tremendous investment of time and money, and with clear and transparent steps to bring Puakea Ranch to the amazing condition it is today, she proceeded. Additionally, along the way saving Puakea Ranch and putting it Ion the state historic register as a gift to the island of Hawaii and to Kohala; Christie accomplished this for the pure joy of protecting and preserving it for future generations. IChristie's vision and enthusiasm for this land and project remains contagious and steadfast. She has every intention of doing what is required of her to obtain her Special Use Permit including limitations on the size of events, etc. I personally know ofthe efforts and legal hurdles she has endured through the years in an effort to I get Puakea Ranch to conform to the standards required of her while also providing an authentic experience to the tourists she hosts. She continues on this path and she has tremendous support from the visitors she has hosted to the economic benefit ofour State, County and North Kohala. She donates stays to local charities and I schools. She is community minded, environmentally conscientious, is farming the land and caring for animals and is extremely sensitive to keeping the impact low on neighboring properties. However this is not the picture the recent article painted ofher, nor the letter Robert Watkin's wrote to you (and by the way he is a competitor I and has never been to Christie's property), nor do her neighbor Mark Torrance's complaints portray the magnitude of the contribution she has made to historic Kohala while also providing jobs to many local residents. The article quotes a neighbor across the highway as saying "this is not what we signed on for...". Everyone of these individuals, especially those who purchased their properties after 2006, including Mark Torrance, had the I opportunity for full knowledge of Christie's guest ranch in their due diligence of the area. In fact, Mark Torrance also had Jack Larson as his agent and he knew full well of Christie's activities before he bought his property. Peoples accusations, including absentee Torrance, Watkin's and other recent grievances, describe IChristie as "negligent, totally illegal, impertinent, non-compromising, a liar, defiant and as "mocking" the laws and the County of Hawaii." Nothing could be further from the truth with perhaps the exception of'defiant' given she has to defend herself from ill-informed people like Watkin's and wealthy, controlling absentee ownersIlikeTorrance, and suits from the county. Being in the business I am in, I know the effects the new STVR laws are having on many individuals who have been operating for years on agricultural zoned lands and I also know most of the like-minded venues such as Puakea Ranch are predominantly located on ag land. This is nothing l new. The Christie Cash myself and so many others know is a hard working, creative visionary with only the best of intentions and desire to be a good neighbor and contributing member to society and the community. She pays her GET and TAT which doesn't get returned from the county, ever. She is committed to complying and wants to cooperate within the full extent of the law. What I see here are individuals who may have some reasonable concerns but nothing that cannot be negotiated, compromised and mediated to the satisfaction of the county and most others. (There will always be someone who just wants to put the ranch out of business for their own personal gain like certain neighbors and competitors or, who just want to build another megamansion that they don't live in.) The implications that the article stated made it sound as if Christie is completely negligent and a common law breaker which is totally unfounded; her very extensive, long term efforts to conform is completely the opposite. Most of these descriptions of her are from people she has repeatedly invited to the ranch so they could see the operation for themselves and yet they magnify and exaggerate the issues without personal knowledge. Mr. Yee I urge you to consider the beauty, the well intended nature of Puakea Ranch and the vital economic and historic component the ranch provides for our Island. We are talking about only 4 cottages that have operated for several years with the full knowledge ofneighbors and county agencies. Absentee owners (and their spies) who don't see the daily comings and goings are not the ones with the knowledge here, the county 2 is, and Christie wants very much to work successfully with you to continue with this unique, now historically protected property and her vision for lavender fields, vegetable gardens and many happy tourists,visiting children and guests from around the world. Please confirm receipt of my email. Sincerely and With Aloha, Rebecca Keliihoomalu Rebecca Keliihoomalu, Real Estate Broker RB-19834 The Rebecca K. Collection at Elite Pacific Properties Island and Statewide Top Producer President and Founder of The Rebecca K. Collection Mobile 808.895.1156 I Fax 808.443.0152 Thus email rind any files transmitted with it are confidential and intended solelyfor the use of the individual orentity to vvhinn they ore addressed.if you have received this email in error please notify the system manager. This message contains confidential information and is intended onlyfor the individual named.If you are not the named addressee you should not disseminate.distribute or copy this e-mail.Please notify the sender immediately by e-mail if you have received this ei mail by mistake and delete this v-miorlfrom your system,Ifyou are not the intended recipient you are notified that disclosing,copying,distributing or taking any action to reliance on the contents of tins information is strictly prohibited. i -. s - .n " cd lila,at urn rultlidoutiul(111(1 tnh'nilrd crab Ir far i/ti 11SC of"(Iii iudii irhill ur entity to whom t/it•are uddh•Gsscd.l"nus email ttu,f tr n Ill(. nuu. lett Please notify flu'sender titin,rhutelc ire-mail i/.you have received thi..r-nurtl/i mistake mid Mac this e-mail frau: our s.v.stent. Il ruu(u s nen theintendedwet/neat you are notified than disclosing.ct(pt'in , 1I1sn'ihttting(ar ae:Anw any action in n('11(110CC toll the contents of i/ifs information is strict/i prohibited. IIF 1 1 1 3 I IMori, Ashley From: Yee, Michael ISent: Saturday, September 28, 2019 11:32 AM To: Mori,Ashley Cc:Ley, Rachelle ISubject: FW: Puakea Ranch r1, l f} I Please intake to Jeff c.) From: Barbara Davis [mailto:barbdavis20@gmail.comj I Sent:Thursday, September 26, 2019 5:33 PMmi To: Yee, Michael <Michael.Yee@hawaiicounty.gov> Subject: Puakea Ranch oo T'n bear Mr. Yee,Z'- 1 r7 I was thrilled to see the headlines of Monday morning's WHT, "Puakea Ranch draft EA finds no impact". Puakea Ranch i li is such an important part of our community. They have generously donated to several auctions, donated venues for community events from fundraisers for North Kohala Community Resource Center, senior luncheons and community gatherings. IHowever, reading further, the article took a turn on the last page, siting opinions of a few people that live well over a mile away from the ranch. It states that an unnamed neighbor at Puakea Bay Ranch "said her and her neighbors almost Iall have the same concerns about Puakea Ranch hosting large-scale events. " She sites increased traffic and noise. We have lived on the ranch for 9 years and we have never heard any noise from Puakea Ranch. We live about a half mile down hill from the ranch so possibly some noise could be heard near the top of the ranch but it would have to be a very 0 still day to allow the noise to travel that far. I think the roosters that live around here would far outweigh any music 4. coming from the ranch! As far as the traffic goes, unless you happen to be coming or going at the exact moment a car would be entering Puakea Ranch, we are essentially unaffected. To state that most of her neighbors have her same concerns is incorrect. I've never been contacted and I live here full time. I've never heard any complaints about noise or traffic on the ranch and I was on the Board for 7 years. I don't understand the comments that were made in the paper and I wanted to make sure that it is known that this is NOT the opinion of the majority of the neighbors. More often than not these days the loudest voices are the only ones l" heard. It takes some extra effort to hear the majority that are living in peace and don't want to stir up trouble. I can only surmise that these loud voices have something personal to gain by pushing the ranch out of business.IIP If you have any questions or need more information, please do not hesitate to call. I'd hate to see this lovely ranch go out of business because of a small group of haters. ilio Thank you for your time Barbara & Bill Davis 56-2996 Puakea Bay Drive I Hawi, HI 96719 808 889 1252 SCANNEDED 1 1 OCT 0 4 2019 1f23.1-02-. Mori, Ashley From: Yee, Michael 1 Sent: Saturday, September 28, 2019 11:31 AM To: Mori, Ashley Cc:Ley, Rachelle r: Subject: FW: Christie Cash and Puakea Guest Ranch/ Noise Issue jo :41= r A: T CD ...,: Please intake to Jeff. From:Alexandra Star [mailtoatarsaffire@gmail.comj Sent:Thursday,September 26, 2019 1:39 PM To:Yee, Michael<MichaeLYee@hawaiicounty.gov> Cc: Christie Cash<christie@puakearanch.com> y Subject: Christie Cash and Puakea Guest Ranch/ Noise Issue z Good Afternoon Michael .. I I guess it is time for me to speak up in this matter. One year ago I purchased the 25 acre property and home that is adjacent to Christie Cash's property. I am her immediate neighbor. In the year that I have resided here, I have heard very minimal noise, if any, emanating from her property, and I am down wind of her place. On two occasions I may have heard a few peals Ioflaughterandsomelightmusic, but not on any prolonged basis, and certainly not sufficient to constitute a 'nuisance' or 'disturbance'. I am here on my property at least 95% of the time. I have no hearing impairments. I find it hard to understand how neighbors who are very much further away from her property than I am can be disturbed by noise. To my knowledge Christie offers the use of her ranch to various schools, charities, and other organizations to come there for free to enjoy a weekend or night out. These are wonderful gifts to our community. Children can be excitable and rambunctious on such occasions, but never to the degree of bothering the immediate neighbors. I just wanted to add these comments to the record, and reiterate that I have never been disturbed by noise coming from Christie Cash's property. I thank you for your fair consideration of my comments. Sincerely yours, Alexandra Star Puakea Ranch Lot 4 SCANNED OCT n 4 20 9 3 n.in* I Mori, Ashley J From: Yee, Michael I Sent: Saturday, September 28, 2019 11:37 AM To: Mori, Ashley Cc:Ley, Rachelle tISubject: FW: Puakea Ranch IPlease intake to Jeff Original Message C.--r,-••., +1• From: Fara Boisvert [mailto:fara.boisvert@gmail.com] Sent:Thursday, September 26, 2019 7:20 PM To: Yee, Michael <Michael.Yee@hawaiicounty.gov>c r Subject: Puakea Ranch E-71 Aloha. I am reaching out to you in concern about issues impacting one of the few sites I am growing a garden at in the community of North Kohala. I have been helping develop the Agriculture production at Puakea Ranch since April of 2018. I was a farmer for the Kohala community since 1998, and have been growing a vegetable garden for the guests, staff, and the community at I the ranch. We sell the produce at the Hawi Farmers Market, as well as fresh eggs they raise there on.The ranch. We also planted a white pineapple field which will begin to yield next summer, and will be expanding fourfold by the end of 2020.We have plans to start producing lavender as well. Since I began working at Puakea Ranch, I have only witnessed a family oriented, very quiet and mellow environment, where young families come to relax, enjoy the rustic country atmosphere there. I have never witnessed any noises in excess of tractors, mowers, and weed eaters, none of which are run before 9 am, and usually finish by 3pm. Before I started working at Puakea, I ran my own organic farm, Sage Farms, for 20 years. I only had heard and read about positive things Puakea Ranch had done for the community like donations of their space for a community fundraiser and senior citizen brunches. I am very well aware how extremely challenging it is do agriculture here in Hawaii, especially in the dry climate where this ranch is located.The owner Christie Cash has so much respect for the land, its history, and our community, and is passionate about creating something beautiful and functional for the guests and community to enjoy for years to come. It's a beautiful, rustic and peaceful place. I am sorry to hear there are a few folks in our community who have made it their mission to impede this vision, and I feel the claims of these few are definitely not the opinion of the many others who live and visit here. Furthermore, it should be noted that some of those in opposition run a high end retreat center here, Hawaii Island Retreat, which hosts weddings and events, and I think they are simply trying to "rub out" the competition with these actions and claims against Puakea Ranch. 1 hope a reasonable resolution comes soon regarding this case. Mahalo for considering my viewpoint. Sincerely, Fara Boisvert, DBA Makana 0 Ka `Aina P.O. Box 1261 Kapa'au, HI 96755 808 895 0279 t SCANNED OCT 0 4 2019 1 Mori, Ashley I From: Yee, Michael Sent: Monday, October 07, 2019 11:03 AM To: Mori,Ashley I Subject: FW: Puakea Ranch, Hawi Please intake to Jeff 3 r- From:From: Marcelle "Malu" Loren 808-545-1000 texts welcome [mailto:mloren@islandmortgagehawaii.comj Sent:Saturday, October 05, 2019 7:22 PM Z To:Yee, Michael<Michael.Yee@hawaiicounty.gov> 1Subject: Puakea Ranch, Hawi I live at Puakea Bay Ranch which is across the street from Puakea Ranch. My address is 56-2898 Haleakala View Place TMK 3-5-6-002-024 I support the commercial venue and innkeeping activities at Puakea Ranch as it contributes to a vibrantpg community that we need to continue to enhance through the efforts of our community entrepreneurs. I do, however, wish to bring to your attention a need to require a change in the design of the entrance to Puakea Ranch as it is currently unsafe for such a commercial operation. The design should provide a sight distance of sufficient length that drivers can control the operation of their vehicles to avoid striking an unexpected object in the traveled way. A motorist exiting Puakea Ranch should be able to see cars, bikes, and people from the driveway fronting the state highway known as Akoni Pule Highway. The site distance has obstructions as there is no current maintenance program of this area performed by Puakea Ranch. As the number of cars entering and exiting Puakea Ranch can be very significant when a venue is active, I also suggest that the driveway be expanded to a 2 lane driveway.3 Marcelle Loren 808-545-1000 3 3 3 SCA NW') OCT 1 if 2[119 1 1 0 4 r-----A----- g I i 14 7 5' 1 114"---4-1------1--------- 51 i I I 4, 'f.? Area clear al Area dear of eudierl, 0 of obstruction 11 I 7V e or ,) fi f, I0 ii1Vu'l, 47, .:, \4.4v4.4Ifi-,,,,,i ,fe. i , ,,,r .L.illt I i- 4,Alk, 0 ES 1 00r 41, P:1147'teI0 `1- '' . I 4 I I II I I I I 1 2 I Mori, Ashley From: Yee, Michael Sent: Tuesday, October 08, 2019 11:17 AM To: Mori,Ashley Subject: FW: Puakea Ranch Please intake to Jeff From: Catalina Cain<catcain@comcast.net> 14V I Sent:Tuesday, October 08,2019 11:11 AM is To:Yee, Michael<Michael.Yee@hawaiicounty.gov>; kohalanewseditor@gmail.com Subject: Puakea Ranch 4y . -- - a 30 Z CO I October 7, 2019 1 Dear Mr. Yee and Kohala Mountain News. I am happily writing to you and the Kohala Mountain News regarding Puakea Ranch. I moved to North Kohala seven years ago to support my son during a difficult time in his life. He was working and living at Puakea Ranch at that time. Christie Cash offered one of her cottages to me free of charge to help make it possible for3metobewithmyson. I was able to experience this property from a very intimate perspective. The beauty and sacredness of the ranch was immediately obvious and over the month I stayed there, this fact sunk deeply into my awareness .That awareness was the keen observation that this piece of land and its history was deeply cared for and respected by 3 Christie. She knows the background of every incarnation the land went through. Her desire to respect the integrity of the history was obvious. She is passionate about her responsibility as a steward of the aina. I It is unfathomable to me that a small number of people can make such a fuss without knowing who Christie Cash is in relationship to the ranch, the community and what she does to benefit North Kohala. She expresses gratitude in having the opportunity to care for this place she calls home. She has told me on many occasions 3 how lucky she feels to have landed here. She generously gifts the ranch for many many events and celebrations to support the needs of our community, from graduation celebrations, classes to our local school-kids-to.senio events and hosts at great personal expense organizations like the resource center's annual i ' r•*NNE OCT14 2013 I . II often have dinner with Christie and Josh along with an array of wonderful people who come to soak in the beauty,the sunsets, the trade winds, the garden, the animals, and the exquisite houses she has decorated and brought back from the dead .Everyone who comes feels blessed to be on the land and comments on the hard Iwork Christie has put in to Puakea Ranch. There are never a noise issue or traffic impact, or fire danger,just loving people being gifted by this special place. I I am so happy that the powers at be found no negative environmental impact at the ranch .So, I hope the smallInumberofcomplainersstopbullying, lying, and trying to intimidate this amazing woman who has for more than 10 years sweat and dug and struggled and persevered adversity to create the magic that happens for everyone who visits Puakea Ranch. ISincerely, Catalina Cain I I I I I I I I I I I 2 I Mori, Ashley From: Yee, Michael Sent: Monday, October 07, 2019 11:03 AM f To: Mori, Ashley Subject: FW: Puakea Ranch 1,,:iPleaseintaketoJeff Original Message From: Karen Johnson [mailto:kdjohnsonmd78@gmail.com] Sent: Saturday,October 05, 2019 11:41 AM To:Yee, Michael<Michael.Yee@hawaiicounty.gov> Subject: Puakea Ranch Dear Mr.Yee,I My husband and I are full time residents at Puakea Bay Ranch.We have never heard any noise nor experienced any traffic from Puakea Ranch. It is impossible to imagine activity at Puakea Ranch could have any impact on residents at Puakea Bay Ranch unless you live next to the highway and I suspect highway noise would be more troublesome. I do not know of the particulars regarding permitting and regulation affecting the ranch, however from a perspective of noise or traffic affecting the community it is non-existent.I Sincerely, IKarenDJohnson 56-3026 Puakea Bay Drive, Hawi, HI C} T 1 co i - 5qy ,.i I I I J I SCAIVN T)I 1 1 Li Z013 21.0.:74 Alli 1 1 Mori, Ashley From: Yee, Michael ISent: Monday, October 14, 2019 8:25 AM To: Mori, Ashley c.o Subject: FW: Puakea Ranch consideration Please intake to Jeff. t From:Virginia Fortner<Vfortner@hotmail.com>y - Sent: Sunday, October 13, 2019 11:31 AM To:Yee, Michael<Michael.Yee@hawaiicounty.gov> Subject: Puakea Ranch consideration IDear Michael Yee, During my seven years in Kohala, I have enjoyed many trips to Puakea Ranch. Each visit has been quiet, Ienjoyable, and made me proud to live near Hawi. I've enjoyed fundraisers under big tents, farm-fresh lunches in two of the cottages, wading in the lava-lined ponds, walking the trails, feeding the resident farm animals, and quiet sunsets with friends. ITwice, the Pleine Aire painters of North and South Kohala spent three hours capturing the ranch's beauty on canvas. At least one watercolor hangs on James Cottage's walls. We were impressed with the historical Iinformation about the area contained in materials for guests to honor the land. This is the second year that Kohala Senior Citizens Club has been invited to a Farm-to-Table "Thank you meal," Ian event that all 65 of them thankfully attend. The kupuna feel appreciated by the Ranch. Please consider the community contribution unique Puakea Ranch makes when you address decisions aboutIit. I would like to continue proudly recommending it to visiting families and visitors. Mahalo, Virginia Fortner 54-469 Honomakau Rd Kapaau, HI 96755 1 1 Ct , 17 BY: -4.2:8-3 6.5_. Matsunaga, Anne From: Chris Helmuth <chris@kohalapacificrealty.com> Sent: Wednesday, October 09, 2019 11:45 AM To: Planning Internet Mail Cc: Chris Helmuth o Subject: Support Letter for Christie Cash at Puakea Ranch T; ' c a Importance: High Aloha Mr.Yee: r I have businesses on both sides of the street in Historic Hawi Town. I also own three properties, commercial and t agricultural/residential here in North Kohala. I liver here, work here, and have raised my family here. As I have already written to you from our real estate brokerage and building, I will be brief: We have been serving in community for over a decade with Christie Cash at Puakea Ranch. Christie practices aloha. She has always,without hesitation, strongly supported our community through providing a venue for our fundraisers, giving money and in-kind donations, serving our seniors, providing jobs to local families(including my own family). Her efforts in creating a guest ranch providing visitors accommodations is a strong benefit to North Kohala and Hawi/Kapaau. It enhances our quality of life and aligns well with our North Kohala CDP and day to day life here. It's low impact. Please do not allow the vocal minority, many of which do not even have standing due to proximity, deceive/infect this process. I heartily recommend APPROVAL of the pending SUP. Respectfully submitted, Chris Helmuth President, CEO Aloha Man Ventures LW 55-3411 Akoni Pule Highway Hawi, HI 96719 P.O. Box 400 Kapaau, HI 96755 Cell 808.895.6431 Fax 808.889.5161 NOTICE TO RECIPIENT:: Aloha. This electronic mail transmission and any attachments contain confidential information and may also be privileged The information is intended only for the addressee. Ifyou are not the named recipientor have otherwise received this communication in error, notify the sender immediately to arrange for the return of the documents it is against the law to disclose their contents to any other person or use them for any purpose.or store or copy them in any medium Although this e-mail and any attachments are believed to be free of any virus or other defects that might affect any computer system into which it is received and opened, it rs the responsibility of the recipient to ensure that it is virus free and no responsibility is accepted by Chris Helmuth,Aloha Man Ventures LLC and or any of its employees Thank you for your consideration SCANNED1 1 k1/41 P R k SCHOOL I Excellence I Integrity I Compassion September 30, 2019 Michael Yee Planning Director 74-5044 Ane Keohokalole Hwy Kailua-Kona, HI 96740 IAloha Mr. Yee, I wanted to write to you regarding our experience with Puakea Ranch in Hawi. We understand there is a complaint from a neighbor regarding noise and other activities. We would like to share our experience. The ranch generously donated the use for our annual back to school campout on August 22, 2019. Students and teachers arrived at the ranch at around 10:30am. The ranch provided rules I and guidelines for the school to follow as to not disturb our neighbors. We followed those rules and guidelines very carefully for the duration of our campout. One example of these rules we followed had to do with noise. We were told that there should be no amplified music after 9:30pm and all noise was to be kept at below 55db at all times. Which we followed at all times during our stay. Another important aspect is making sure that we brought our own portable toilets to the campout lb (Port-O-Potties). We had 2 portable toilets that were dropped off at the ranch the day of our arrival and picked up the day of our departure. The campout was chaperoned at all times by teachers and administrators. It is very important for us to make sure this is the case for our students safety. p. We appreciate the opportunity to share with you the experience we have had with Puakea Ranch. Please let me know if you have any questions. lib Sincerely, Gerry Delgado Chief Operating Officer p 808-885-7933 ext. 7136 www.parkerschoolhawaii.org 14 PARKER SCHOOL I 65-1224 Lindsey Rd., Kamuela, HI 96743 (808)885-7933 www.parkerschoolhawaii.org I Mori, Ashley 91/O010M From: Yee, Michael Sent: Tuesday, October 01, 2019 12:30 PM ti To: Mori,Ashley rTh Subject: FW: Puakea Ranch North Kohala c• Ashley, c IPleaseintaketoJeff. z N Original Message From: Andi Longpre<andi@hawaii.rr.com> s ISent:Thursday,September 26, 2019 3:52 PM To:Yee, Michael<Michael.Yee@hawaiicounty.gov>; Kanuha, Duane<Duane.Kanuha@hawaiicounty.gov> Subject: Puakea Ranch North Kohala Dear. Mr,Yee and Mr. Kanuha: On Monday September 23,2019 I read the front page article in West Hawaii Today. The headline stated that Puakea Ranch draft EA finds no impact. As a long term resident of Kapa'au(20 yrs) I was relieved to read the article. However, as I read further I noted that people who had previously attempted to shut the Ranch down are continuing their efforts. I am aware of the Ranch's role in our community. The Ranch employs local residents for various activities such as cleaning and landscaping . The Ranch has also hosted community fund-raising events for Kohala Hospital and the North Kohala Resource Center and provides a Thanksgiving lunch for the Kohala Senior Citizens Club. When visitors stay at the Ranch they contribute to our local economy by visiting and shopping at businesses in Hawi and Kapa'au. Towards the end of the article the draft EA states that hours for all events would be limited from 9 a.m.to 8 p.m. Sundays through Thursdays, and 9 a.m.to 10 p.m. Fridays and Saturdays. The neighbors' opposition refers to "large- scale events". Is this a reference to the fundraisers noted above? I am also aware that Robert Watkins, M.D. has written an intensely critical letter about the Ranch and has aligned himself with some of the residents of Puakea Bay Ranch in their opposition to Ms. Cash's venture. I am also aware that Dr. Watkins and his wife,Jean Sunderland, own and operate Hawaii Island Retreat which is located in Kapa'au and is a venue for"events". I am also aware that when Puakea Ranch is at capacity, (4 separate buildings for guests) Ms Cash has referred visitors to either Hawaii Island Retreat or Kohala Village Inn. One may argue that Ms. Cash made some mistakes in her initial efforts to restore The Ranch and obtain all the necessary permits. My understanding is that in order to obtain a special use permit it was necessary to first have the EA done. She has complied with that request. I am asking that the Planning Dept.allow Ms Cash to continue in her efforts to be in compliance with the rules and regulations of the Planning Dept. and continue to provide employment and a venue for community events. As an aside: I live within a quarter mile of Kamehameha Park. Throughout the years there have been events with high intensity bands into the late evening. Would it be appropriate for my neighbors and Ito ask Parks& Rec. Dept.to no longer issue permits because these events occasionally"disrupt the tranquility of our neighborhood"? I think not because we support efforts to provide safe local activities. I urge you to investigate further the motives of non-residents and competitors who have initiated these complaints and not to grant the injunction. 1 128164 1 Mahalo for your time and attention to this request, 1 Andrea J. Longpre(Andi) 1 I 1 1 I 1 1 I 1 1 1 1 1 1 1 1 1 1 2 Begin forwarded message: From: term Johnston <termnjohnston29gmaiI.com> Date: October 9, 2019 at 4:04:37 PM HST Tw: cnichueiyee@howuiicountygov Subject: Retraction letter Sent from my iPad 0 Dear Mr. Yee, I am writing to you to ask that my previous letter to you in regards to the Puakea Ranch be retracted. The reason being is I feel that I wrote you in haste and sadly with only one side of a story. Christie Cash had responded to my emails with an invitation to come see for myself what was in question. My neighbor and I went to visit her yesterday and were astonished at what they've accomplished and what was transpiring with the heritage listed site. I asked many questions as we were given a full tour of the cottages, garden, grounds and pavilion. Christie was forthcoming and open. I understand that she is seeking to resolve the issues with fines, building permits and similar administration formalities. I'd hate to think that this special Hawaiian historical site could be torn up or made into another mega mansion. There could be no better preservation than to have visitors enjoying an old Hawaiian homestead here on the Big Island. Hopefully there will be a positive outcome and we can all be better neighbors with support and Aloha for one another. Thank you for your time, lerinjohngon I C C IMori, Ashley From: Yee, Michael ISent: Thursday, October 10, 2019 8:37 PM To: Mori, Ashley 7' Cc:Darrow,Jeff I Subject: Fwd: Puakea Ranch Complaint J Please intake to Jeff. Jeff-hmm...the eventual Commission meeting is going to be interesting...y tSent from my iPhone I Begin forwarded message: c From: Bridgette Sterling<alohasterlings@gmail.com> Date: October 10, 2019 at 4:59:42 PM HST ITo: "Yee, Michael" <Michael.Yee@hawaiicounty.gov> Subject: Puakea Ranch Complaint c w IDear Mr. Yee, I We are writing to respectfully ask that you disregard our previous complaint filed against Puakea Ranch on September 20. We have had the pleasure of meeting with Ms. Cash at her facility and now have a better understanding of her vision moving forward. We feel there will be no impact I on us what so ever. Ms. Cash's hard work and perseverance shines through in each of the beautiful units the County has placed on the Historical Registry. ISorry to have taken your time on this. We were sadly misinformed. I Aloha, Bridgette&Michael Sterling I I I I seA DIOCTia20;3 1 by:12,8379 1 Mori, Ashley 1 From: Yee, Michael Sent: Monday, October 14, 2019 8:35 AM To: Mori, Ashley 3 Subject: FW: Puakea Ranch Complaint Please intake to Jeff. 4 I. C From: Bridgette Sterling<alohasterlings@gmail.com> Sent:Thursday, October 10, 2019 4:58 PM To:Yee, Michael<Michael.Yee@hawaiicounty.gov>1,4.) Subject: Puakea Ranch Complaint Z ry Dear Mr.Yee, We are writing to respectfully ask that you disregard our previous complaint filed against Puakea Ranch on September 111 20. We have had the pleasure of meeting with Ms. Cash at her facility and now have a better understanding of her vision moving forward. We feel there will be no impact on us what so ever. Ms. Cash's hard work and perseverance shines through in each of the beautiful units the County has placed on the Historical Registry. Sorry to have taken your time on this. We were sadly misinformed. 1 Aloha, Bridgette & Michael Sterling I SCA N a6 6 1 Mr. Michael Yee & Mr. Daryn Arai County of Hawai'i Planning Department 1 101 Pauahi St. Suite 3 Hilo, HI 96720 Aloha Messrs. Yee & Arai, I support the application of Puakea Ranch for a Special Use Permit to operate as a Guest Ranch. Christie Cash has done a wonderful job of renovating and preserving this beautiful historic Ranch and its structures. I believe she has the motivation and capability to execute her plans for the Ranch. As a former Director and Treasurer of the North Kohala Community Resource Center, our organization is very grateful to Christie for allowing us to use her property for three very successful charitable fundraising events over the past four years. I worked directly with Christie and was impressed by her generosity and professionalism. Puakea Ranch currently provides unique accommodations for visitors to North Kohala who do not want to stay in the rundown Kohala Village Inn or go through Airbnb or VRBO. Her guests spend money and help sustain the retail stores, groceries, restaurants and recreational activities in Hawi and Kapaau. I know this first hand because I also work at a shop in Hawi. Her vacations rentals help provide employment in the area and support the tax base. Her plans to expand activities at the Ranch will continue its beneficial impact on the community. Please approve Christie's application for a Special Use Permit. I would be happy to discuss any questions or make additional comments -my contact information is below. Mahalo for your consideration, Alida Adamek 55-280 Uli Road - POB 540 Hawi, HI 96719 1 808-938-2200 Alidam007Aaol.com 1 I I Bamboo Restaurant & Gallery P.O. Box 1463, Kapaau, HI 96755 808-889-5555 Fax 889-6152 bamboorestauranthawaii@gmail.com bamboorestauranthawaii.com June 2, 2017 Mr. Michael Yee &Mr. Daryn Arai 3 County of Hawai'i Planning Department 101 Pauahi St. Suite 3 Hilo, HI 96720 3 Aloha Mr. Yee and Mr. Arai, 3 I am writing you in regard to the issuance of a "Guest Ranch"permit to Puakea Ranch in North Kohala.3 As owner of one of the long standing commercial establishments and 3oneofthelargestemployersinourcommunity, I would urge you to issue this permit to Puakea Ranch. The Ranch has been an asset to our community since its inception, hosting events, contributing resources, and bringing 3 guests into our towns. There has been absolutely no "downside" to the Ranch in our community and the issuance of a Guest Ranch permit will 3allowthemtofurtheraidandassisttheNorthKohaladistrict. I wholeheartedly urge you to issue this Guest Ranch permit, to allow our community and region to grow in a sustainable and energetic fashion, and to allow Puakea Ranch to fulfill it's highest and best purpose. 3 Thank you for your attention. 3 Sincerely, Joan Channon, Owner, 3 Bamboo Restaurant & Gallery 1 Mr. Michael Yee & Mr. Daryn Arai County of Hawai'i Planning Department 101 Pauahi St. Suite 3 Hilo, HI 96720 Subject: Puakea Ranch NOV for operating a "Guest Ranch" TMK 5-6-001:082 X Dear Mr. Lee & Mr. Arai, We are writing to you as residents of the North Kohala community in support of Puakea Ranch. We understand they are applying to obtain a Guest Ranch Use permit and we fully support this endeavor. The Ranch is a special part of our community and to provide more access through special events like enrichment classes, yoga classes, Kite Festival, and pancake breakfast would be a great addition to the community. Not to mention the jobs and exposure to local businesses they would provide. With no apparent downside, we can't see why the permit would be denied. Thank you, Barbara & Bill Davis 56-2996 Puakea Bay Drive, Hawi r fr r To Mr. Michael Ye and Mr. Daryn Arai May 23, 2017 County of Hawaii Planning Department 101 Pauahi St. Suite 3 1Hilo, HI, 96720 Subject: Puakea Ranch NOV for operating a"Guest Ranch"TMK 5-6-001:082 I Dear Sirs, My name is Mrs. Bindi Wiernicki and I have been a highly qualified teacher at Kohala El. School for 13 years. I currently teach 1"grade. I am writing to you today to ask that you allow Ms. Christie Cash to create a"guest ranch" at her home. As a teacher I am always looking for places to take my students that are educational, fun, preferably close by, and affordable. This property has so much history that Ms. Cash has tried so hard to maintain and keep intact. The old buildings on it have been updated and painted but are the original structures. She has created an atmosphere that is laid back and welcome to all,- from the smallest of children to the oldest adult. If the "Guest Ranch" status were allowed to happen, then as a school we would be able to visit and learn about local history and ranching, animals , farm to table living from the garden , and even have some horse rides thrown in there as well. As the first Blue Zone school in Hawaii we would love to take advantage of this learning opportunity. With the growing costs of transportation, a trip on the bus for our keiki can cost up to $10 sometimes. Our parents cannot afford much more. This ranch is close by and gives us another venue to travel too that is something different. We could even have a picnic and a nature walk up there. My teacher's brain is just brainstorming ideas as I type because this would be such a great adventure for the children of Hawaii. On a personal note my husband and I have known Ms. Cash for almost as long as she gni has owned this property. My husband Vince Wiernicki is a Hawaii county lifeguard and owns a small yard service company. I have watched the buildings that were old and falling down become shiny and new again. The ranch's integrity and heritage is still there when you drive up the long winding road to the main house. There is a wonderful feeling that you get when you drive up the road. You know that this is a very special place. My daughter has had the chance to work at the ranch this past year and a half tending the horses there. Having this small job has helped her pay for her 4H and rodeo fees, horse shoes, and horse apparel all by herself. There is not much work up in Kohala so being asked to tend these horses was a great gift for her. My husband has been asked to cut the grass and to do odd jobs around the property as well. At times that has been money that was much needed. I see this ranch giving other local people a chance at having a job near their home as well. What a great vision Ms. Christie has created for the future generations of Kohala. I am hoping that this letter will have a great impact on your decision for her request to allow this ranch to become a"Guest Ranch" in Kohala. We need our historical properties to thrive and be saved. The history in Kohala needs to be preserved and passed on not forgotten. Mahalo for your kokua in this decision that will impact many little lives. r„ Sincerely, Mrs. Bindi Wiernicki I IMay 26, 2015 I Mr. Michael Yee & Mr. Daryn Arai County of Hawai'i Planning Department 101 Pauahi St. Suite 3 Hilo, H196720 Gentlemen, II am a long term resident of North Kohala, living in down town Hawi, and have been involved in the community here since the late 1980's. I've created several successful for-profit Ibusinesses, founded the North Kohala Community Resource Center, served as vice chair on the North Kohala Community Development Plan Steering Committee, and as the first Chairman of the CDP Action Committee. I think I have a reasonably accurate grasp of the community'sIgeneralinterests. With this background in mind, I am writing to support Puakea Ranch in their request to yam obtain a Guest Ranch use permit. It will allow the owners to increase the variety of opportunities at their ranch to the community and their guests: from outdoor cooking and organic gardening to P Plein air art and yoga classes. Additionally they would be able to develop a special events a calendar that would include programs like the Summer Pancake Feast and Kite Festival as well as history and enrichment programs. Speakers and teachers would be primarily recruited from bp the community and expanding our ranch/farm operations would bring additional employment opportunities. The future of Puakea Ranch is to be a self sustaining working ranch and farm, committed to increasing the volume and variety of our food crops and expanding the orchards for a true farm to table experience. All of these activities will enrich the community and provide ways for visitors to better understand Hawaii as a great place to visit. Very importantly, it will help with growing our local economy and increasing the number of local job opportunities for our residents. Thank you for your consideration of this request. I hope you will be able to support it with the Planning Commission and that a Guest Ranch permit will be granted. 1 ce -1y, ninc---- Bo• Martin l` P. 0. Box 2 Hawi, HI 96719 a I 1 From: Chris Helmuth <chris kohala acificrealtFro com>@ p Y Subject: FW: North Kohala/Puakea Ranch/Letter of Support for Guest Ranch / Letter Second Separate Business Date: May 30, 2017 at 1:18:57 PM PDT To: Christie Cash <christie@puakearanch.com> From: Chris Helmuth Sent: Thursday, May 25, 2017 9:24 AM To: 'planning@hawaiicounty.gov' planning@hawaiicounty.gov>Subject: North Kohala/Puakea Ranch/Letter of Support for Guest Ranch / 111 Letter Second Separate Business Mr. Michael Yee-Planning Director Mr. Daryn Arai-Deputy Director County of Hawaii Planning Department 101 Pauahi St., Suite 3 Hilo, HI 96720 Aloha Mr. Yee and Mr. Arai: I understand Puakea Ranch is requesting that they obtain Guest Ranch status through a SPU. I have observed its operation for many years. It is a real asset to the North Kohala Community in that they provide a rare Historically renovated ranch setting for locals and visitors to Kohala to enjoy the Puakea Area. Christie Cash has poured her heart and soul into this effort, and she has a big vision for program at the Ranch. She provides many jobs, and her guests shop in our Hawi and Kapaau towns on a regular basis. Further, she has provided activities for many of the kids in Kohala including my own). She also offers her venue to the entire community at a semi-annual fundraiser for the North Kohala Community Resource Center which attracts 300-400 residents to an evening under the stars (with John Cruz often! ). It would be a great loss if a few hampered her 1 efforts. I support her goals and future plans and I believe what she does at the ranch now it just great. I recommend you provide I her with her permit requested. Chris Helmuth President, CEO1AlohaManVentures LLC 55-3411 Akoni Pule Highway Hawi, HI 96719 P.O. Box 400 Kapaau, HI 96755 Cell 808.895,6431 Fax 808.889.5161 NOTICE TO RECIPIENT: Aloha. This electronic mail transmission and any attachments contain confidential information and may also be privileged. The information is intended only for the addressee. If you are not the named recipient, or have otherwise received this communication in error, notify the sender immediately to arrange for the return of the documents. It is against the law to disclose their contents to any other person or use them for any purpose, or store or copy them in any medium. Although this e-mail and any attachments are believed to be free of any virus or other defects that might affect any computer system into which it is received and opened, it is the responsibility of the recipient to ensure that it is virus free and no responsibility is accepted by Chris Helmuth, Aloha Man Ventures LLC and or any of its employees. Thank you for your consideration. June 5, 2017 Mr. Michael Yee & Mr. Daryn Arai County of Hawai'i Planning Department 101 Pauahi St. Suite 3 Hilo, HI 96720 Subject: Puakea Ranch NOV for operating a "Guest Ranch" TMK 5-6-001:082 Aloha Mr. Yee & Mr. Arai, I am writing today to voice my support of Puakea Ranch's goal to secure a special Use Permit to operate as a Guest Ranch. In addition to all of the new activities the ranch would be able to offer, that the gardens and grounds would be open to local schools (where my sons attend), community and seniors groups to experience ranch life or learn about the history of the surrounding area, plantation life, Paniolos, Japanese and native Hawaiian cultures is a prospect that is really exciting to me as a proud Kohala resident Puakea Ranch hopes to offer a variety of opportunities, special events & programs, as well as history and enrichment programs. I also think that their goal to be a self sustaining working ranch and farm is great. Puakea's commitment to our community and beyond is commendable, something I've witnessed for nealy eight years now. Any effort at bringing our community together should be encouraged. Mahalo for considering my support for Puakea Ranch's Guest Ranch Permit - Sincerely Marci Elizondo Halaula, North Kohala June 5, 2017 Mr. Michael Yee & Mr. Daryn Arai County of Hawai'i Planning Department 101 Pauahi St. Suite 3 Hilo, HI 96720 Subject: Puakea Ranch NOV for operating a "Guest Ranch" TMK 5-6-001:082 Aloha Mr. Yee & Mr. Arai,a , Please count me among the Kohala community members that support Puakea Ranch's goal to secure a special Use Permit to operate as a Guest Ranch. This ranch has been in operation for several years now, as a stable, friendly community- minded business and attractive location for visitors and residents alike to enjoy themselves. Now that they would like to offer more activities and events & programs for Kohalans and visitors to enjoy, I'm proud to add my name to the list of supporters for this permit. Puakea Ranch plans to offer history and enrichment programs and become a self- sustaining working ranch and farm. All of this will only add to Kohala's standing as an attractive place to visit, and will surely bring more travellers up to enjoy the other attractions and activities, spreading the wealth for a much-deserving community. so Sincerely, Christopher Scelza Halaula, North Kohala I I I May 22, 2017 I Mr. Michael Yee &Mr. Daryn Arai County of Hawai'i Planning Department 101 Pauahi St. Suite 3 Hilo, HI 96720 Reference: Puakea Ranch NOV for operating a "Guest Ranch" TMK 5-6-001:082 Aloha Mr. Yee and Mr. Arai, My name is Christine Richardson and I have been an active member of the North Kohala community for over 23 years. I have served as registered nurse for North Hawaii Hospice for over 20 years and full time as the Executive Director of the North Kohala Community Resource Center for 14 years. The Center thrives as an organization which provides support, education and bridges to funding as a fiscal sponsor and coach for over 90 community improvement projects. This work has given me the opportunity to witness firsthand the efforts by so many folks to make Kohala a great place to live and work. Christi Cash of Puakea Ranch is one of those folks. I am writing on behalf of Ms. Cash in support of her request for Puakea Ranch obtaining a Guest Ranch use permit. I have known Christi Cash in community for twelve years and have followed her efforts to carefully and respectfully restore Puakea Ranch in North Kohala. I believe the community as a whole supports her efforts to preserve and restore a very special piece of our Paniolo history that would have otherwise fallen into ruin without her attention and investment. Thanks so much for your time and consideration of this matter. Please consider granting her this permit so she can maintain the high level of integrity and preservation for this historical ranch. w Mahalo, Christine Richardson P.O. Box 509 Hawi, HI 96719 808-895-6108 01 i 0 1 I Mr. Michael Yee & Mr. Daryn Arai May 23, 2017 County of Hawai'I Planning Department 1 101 Pauahi St. Suite 3 Hilo, HI 96720 Subject: Puakea Ranch NOV for operating a "Guest Ranch" TMK 5-6- 001:082 Dear Mr. Yee and Mr. Arai: We are writing in support of Puakea Ranch becoming a "Guest Ranch" under the special use permitting in the State of Hawaii. Puakea Ranch has once again become a very special setting in North Kohala. The current owner, Christie Cash, has brought it back in grand style and has restored it to a property that everyone in Kohala is proud to have as a representation of what North Kohala was and continues to be. I have seen the transformation of run down buildings and overgrown fields into beautifully restored guest houses and picturesque gardens and grounds. The community has enjoyed sharing in the beauty of this property. The Ranch has graciously donated its use for community events and offered it for local weddings and graduation parties. It is now woven into the fabric of the lives of the North Kohala people and we would like to see that continue and expanded in the years to come. With the generosity of the current owner and the love of the land and its history coupled with the excitement in the community for what opportunities lie ahead for the Ranch, it is an exciting time for itsOR growth. We hope that you will see the wisdom behind granting the es Special Use Permit to operate Puakea Ranch as a Guest Ranch. This will allow the dreams of the community to take place in the form of educational programs, therapeutic programs, historical connections, and fun festivals and gatherings. Thank you for your consideration of this request. Sincerely, Steve and Katherine Groves I From: Lisa Ebrahimi <ashawiturnsl@gmail.com> Date: May 24, 2017 at 2:10:45 PM PDT To: Christie Cash <christie@puakearanch.com> Mr. Michael Yee & Daryn Arai I am writing to you to inform you on my support of Puakea Ranch Special Use Permit Request. I am a business owner of 26 years in Hawi. I have owned two businesses in Hawi in that 26 years. I currently own "As Hawi Turns", a downtown clothing store with jewelry and home accessories. I have been involved in running the Kohala Country Fair. I have also been a creative movement teacher at Kohala elementary school and danced hula at Kamehameha Day Celebration. I have known Christi Cash for over 13 years. The amount of care Christi has put in restoring and preserving the plantation homes at Puakea ranch is immense. She has invited many groups of children and adults at her expense to experience and learn the history of Puakea Ranch. The guests that stay at the ranch directly impact my business and the businesses around me. Almost all of her guests come to Hawi to shop and eat and partake in activities like the zipline and ATV tours. Our businesses are positively impacted by her guests. Our little town needs Puakea ranch. The ranch draws many people to our area who otherwise would not have visited Hawi or Kapaau. Please accept and support her request for a Special Use Permit. Thank you, Lisa Ebrahimi As Hawi Turns PO Box 178 55-3412 Akoni Pule Hwy Hawi, Hi 96719 ashawiturnsl@gmail.com r I 1 5/23/17 To: Mr. Michael Yee & Mr. Daryn Arai County of Hawaii Planning Department RE: Puakea Ranch Special Use Permit 1 Sirs, In regards to the above application for a special use permit, we fully support the future use of Puakea Ranch to include community events and activities, as well as self-sustaining lifestyles and education. It is a beautiful and historic property with tremendous potential for adding local employment opportunities and growth as well. As a neighbor, and having attended fundraising events on the Ranch, we can all be assured of a professional and competent approach to all aspects of development moving forward. We are confident Christie Cash is capable of such an endeavor. Sincerely, Lowell and Dana Bostrom 56-2970 Puakea Bay Drive Hawi, HI 96719 PO BOX 778 Kapa'au, HI 96755 p I e• Andrea Longpre Susan Ince PO Box 762 Kapa'au, HI 96755 May 22, 2017 Michael Yee Daryn Arai County of Hawai'i Planning Department 101 Pauahi St., Suite 3 Hilo, HI 96720 Dear Sirs, We are writing in support of the Guest Ranch use permit for Puakea Ranch in North Kohala. Since Christie Cash has owned Puakea Ranch, she has been a dynamic part of the Kohala community. Whenever we have helped organize fundraising silent auctions for local organizations, she has offered stays in the vacation cottages, and these have generated substantial and much-needed funds. To support the North Kohala Community Resource Center and the Kohala Hospital Charitable Foundation, she went even further in her generosity - hosting fundraising events on the property in addition to including vacation rentals in the auction items. Puakea Ranch has employed local residents for the diverse tasks needed to maintain the grounds, cottages, and animals on the ranch. Current and past employees we know have found her to be a fair employer who rewards their work and encourages their career development and their input into the workings of the ranch. The animals are cared for beautifully, and we have no doubt that she and her staff will be capable of offering a safe and enriching guest ranch experience. In our small community, we are limited in the number of venues available for classes and special events, and we would welcome the addition of Puakea Ranch as an appropriate setting for events highlighting Hawaiian history and sharing the talents of people in our area. LETTER OF TRANSMITTAL JPE CIVIL AND ENVIRONMENTAL ENGINEERING DATE:FEBRUARY 18 2020 POBOX 551751 ATTENTION: ALEX ROY Kapa'au HI 96755 808-854-4888 TMK: 3) 5 — 6 — 001 : 082 TO: Michael Yee, Director Planning Department County of Hawaii Aupuni Center, 101 Pauahi Street, Suite 3 Hilo, HI 96720 Subject:EA— PUAKEA GUEST RANCH PLEASE FIND THE ATTACHED TRANSMITTED FOR REVIEW AND USE: 5=1 1 COPIES DATE PAGES DESCRIPTION 3 02/14/2020 343 ILAL EA — Puakea Guest Ranch COMMENTS: Per your email request. attached, three hard copies of the FEA for submission to OEQC. Sincerely, Planning Dept. Jim Pe.ers PE Exhibit JPE 1 131449' DAVID Y.IGEil.or',rt. T.BUTAY GOVERNOR t* l Vi i t. DIRECTOR r' .Deputy Directors1.,,-- ,:::,(1 LYNN A.S.ARAKI-REGAN N. DEREK J.CHOW ROSS M.HIGASHIc. } EDWIN H.SNIFFEN STATE OF HAWAII IN REPLY REFER TO: DEPARTMENT OF TRANSPORTATION STP 20-103 869 PUNCHBOWL STREET STP 8.2993HONOLULU, HAWAII 96813-5097 August 14,2020 i-: PiFINNING DEPT MI6 3-9 } s h I69 020 pm2s22Mr.Michael Yee DirectorE_C'D F='Y MAIL Planning Department County of Hawaii 101 Pauahi Street, Suite 3 Hilo,Hawaii 96720 Dear Mr. Yee: Subject: Special Permit Application(SPP 20-000219) Puakea Guest Ranch North Kohala, Hawaii Tax Map Key: (3) 5-6-001:082 The Hawaii Department of Transportation(HDOT) has reviewed the subject application and understands Puakea Ranch(dba Kupunakane Ranch LLC) is proposing to develop a Guest Ranch which would increase accommodations from 18 to 38 guests, host group activities such as weddings and family reunions with a 100-guest maximum, and twice per year accommodate community events with a 350-guest maximum. The project area will be a 14.96-acre portion of the 32.411-acre property with an access roadway intersecting Akoni Pule Highway(State Route 270)near Mile Post 18. HDOT has the following comments: Airports Division(HDOT-A) 1. The proposed guest ranch is approximately two miles from Upolu Airport. All new developments within five miles from Hawaii State airports are advised to read the Q, Technical Assistance Memorandum (TAM) for guidance with development and activities 0thatmayrequirefurtherreviewandpermits. The TAM can be viewed at this link: http://files.hawaii.gov/dbedt/op/docs/TAM-FAA-DOT-Airports_08-01-2016.pdf. CO 2. Federal Aviation Administration(FAA) regulation requires the submittal ofFAA Form C .12 7460-1 Notice of Proposed Construction or Alteration pursuant to the Code of Federal 0 "gRegulations, Title 14,Part 77.9, ifthe construction or alteration is within 20,000 feet of a G. LLt public use or military airport which exceeds a 100:1 surface from any point on the runway of each airport with its longest runway more than 3,200 feet. Constructs equipment and staging area heights, including heights of temporary construction co€f%NN o AUG 2 5 2020 0,,.135405 Mr. Michael Yee STP 8.2993 August 14, 2020 Page 2 must be included in the submittal. The form and criteria for submittal can be found at the following website: https://oeaaa.faa.gov/oeaaa/external/portal.j sp. 3. The Airport Zoning Act, Hawaii Revised Statutes, Chapter 262,requires HDOT-A to prevent hazards and non-conforming uses that conflict with the FAA Hazardous Wildlife Attractants requirements. HDOT-A requires that the proposed construction, landscaping and operation of Puakea Guest Ranch does not create a hazardous wildlife attractant. Please review the FAA Advisory Circular 150/5200-33C, Hazardous Wildlife Attractants on Or Near Airports for guidance. If the improvements result in a wildlife attractant, these effects shall be immediately mitigated by the developer or owner upon notification by the HDOT-A and/or FAA. 4. The Applicant and guests at Puakea Guest Ranch should be aware ofpotential single event noise from aircraft operations. There is also a chance for fumes, smoke,vibrations, odors, etc.,that may result from occasional aircraft flight operations over the project location. Highways Division(HDOT-HWY) HDOT-HWY previously provided comments in letter HWY-PS 2.9154 dated January 7, 2019 on the Hawaii Revised Statutes, Chapter 343 pre-assessment consultation materials and requested a Traffic Assessment. The HDOT-HWY subsequently reviewed the Draft Environmental Assessment(EA), including the Traffic Assessment Report(TAR) dated January 31, 2019, and provided comments on the Draft EA in letter HWY-PS 2.1257 dated October 9, 2019. HDOT-HWY has reviewed the Special Permit Application and the revised TAR, dated November 18,2019. These project materials adequately address or acknowledge previous HDOT-HWY comments. The HDOT-HWY has the following comments on the Special Permit Application: 1. The trip generation associated with year-round guest house operations,the occasional private special events(100 visitors) and the semi-annual community events(350 visitors) would not have significant adverse impacts on Akoni Pule Highway peak traffic conditions. Most of the trips would occur outside of peak traffic hours. 2. There is potential for Puakea Guest Ranch events to adversely impact traffic safety at the access driveway on Akoni Pule Highway. We anticipate the impact would be less than significant due to the following mitigation measures: 1)the line of sight at the driveway approximates 1,000 feet in both directions and the vegetation along the property line is maintained; 2)no parking is allowed on State highways, eliminating pedestrian traffic and impacts to line of sight; 3) shuttles and carpooling would continue to be encouraged for private events; 4)temporary traffic control personnel would be hired, as needed; and 5)the owners propose to paint a stop line on the driveway, as a reminder that a full stop is required before entering the intersection. 1 1 We hope that you will approve the guest ranch permit for this important local resource. Please feel free to contact us if you have any questions. 1 Sincerely, 1 Andrea Longpre 1 Susan Ince 808-889-6238 1 1 i i 1 i 1 i 1 1 1 1 1 f • a Mr. Michael Yee STP 8.2993 August 14, 2020 Page 3 3. We recommend the safety mitigation listed above and the following actions identified in the application be included as conditions to the Special Permit: a. If unanticipated safety impacts attributable to the site operations are identified,the owners will mitigate the impact to the satisfaction of the HDOT-HWY,Hawaii District Engineer. b. The owner will consult with the HDOT-HWY, Hawaii District Engineer prior to increasing the site's trip generation to determine the need for driveway improvements to meet current State roadway design standards. If there are any questions, please contact Mr. Blayne Nikaido of the HDOT Statewide Transportation Planning Office at (808) 831-7979 or via email at blayne.h.nikaido@hawaii.gov. Sincerely It/x JADE T. BUTAY Director of Transportation lRt;'y 1959e1 1Alt41-4 z' DANIEL E.ORODENKER DAVID Y.iGE ac: _^' Executive Officer Governor LAND USE COMMISSION Department of Business,Economic Development&Tourism State of Hawaii August 12,2020 Mr.Michael Yee,Director Planning Department County of Hawaii 101 Pauahi Street, Suite 3 Hilo,Hawai'i 96720 Dear Mr. Yee: Subject: Special Permit Application(SPP 20-000219) Puakea Ranch.DBA:Kupunakane Ranch LLC To Operate Puakea Ranch as a Guest Ranch Offering Activities and Events to Guests and the Local Community Tax Map Key: (3)5-6-001: 082 We are in receipt of your memorandum dated July 23, 2020, forwarding the subject application. Based on our review of the application, we understand that the Applicant proposes to establish a guest ranch on the 32.411-acre subject parcel that will offer activities, opportunities, and events to guests, local schools, and local community members. Included in the list of proposed activities are marriages,birthday parties, anniversary celebrations, and farm to fork events. Private events for non-guests will also be hosted at the guest ranch. Horseback riding, self-guided ranch tours,equine therapy, and cooking, art, and yoga classes are some of the activities that will be available. The area proposed for the use will consist of a 14.9-acre portion of the subject parcel. The remaining area will continue to be used as grazing pastures, orchards, animal corrals, and open space. Q We further understand that the guest ranch will be able to accommodate as many as 38 L1 4. visitors in the seven rental units and the event area. Events with more than 38 guests will be al limited to Friday,Saturday, and Sunday, and operate during the hours of 9:00 a.m. to 8:00 •_C w. p.m. (Sunday to Thursday) and 9:00 a.m. to 10:00 p.m. (Friday and Saturday). The C -Q c maximum number of persons on the site at any given time for guest events will be limited to 0 X100outsideguests. However, the Applicant desires to host up to two community events u annually that will allow up to 350 guests. Event hours for these events will be limited to 9:00 a.m. to 9:00 p.m. (Sunday) and 9:00 a.m. to 10:00 p.m. (Friday and Saturday). SCAN235SOUTHBERETANTASTREEToSUITE406eHONOLULU,HAWAI'i 96813 sp TEt.:(808)587-3822 FAX:(8 )587-3827 EMAIL:dbedt.luc.webehawaii.gov AUG 18 2021MAILINGADDRESS:P.O.Box 2359,Honolulu,Hawaii 96804 1, 5 2 5 7 Mr. Michael Yee, Director August 12, 2020 Page 2 The guest ranch will also include port-a-potties and a certified kitchen for catering and utilize the existing swimming pool and poolside pavilion. Based on this understanding,we have the following comments: 1) We confirm that the subject parcel is designated within the State Land Use Agricultural District. 2) According to the application, four individuals were contacted and interviewed for the Cultural Impact Assessment("CIA"). Based on the findings of the CIA,it was determined that"[n]o traditional cultural properties or practices were identified within the project area during this study" and that"[t]raditional cultural practices and properties may be present in Puakea Ahupua'a,but the proposed use of the ranch should not interfere or have a negative impact upon them." Given that there is the possibility of traditional cultural practices and properties on the site,we believe that it is important to cast as wide a net as possible in assessing all valued cultural, historical, and natural resources, including customary and traditional rights of Native Hawaiians, that may exist on the site. Although we note that the Office of Hawaiian Affairs and members of the North Kohala community were contacted, clarification should be provided as to whether the Applicant also contacted members of the Aha Moku Advisory Committee as part of the CIA. If not, we believe that such contact should be initiated to determine whether there are, in fact, additional members of the community with specific knowledge of the cultural resources in the area that should be consulted. 3) We note that while the CIA focused specifically on the 14.9-acre application area, the archaeological inventory survey ("AIS") involved only the 2.14 acres that will be subject to ground disturbance. We question whether this is sufficient considering the historic nature of the existing ranch buildings and surroundings. Given the long history of the site as a working ranch, there may be subsurface artifacts within the other portions of the application area that may be inadvertently disturbed during the planned activities at the guest ranch. Without a comprehensive survey of this additional area, we do not believe that the AIS meets the three-prong test regarding valued cultural, historical, or natural resources set forth in the Hawai'i Supreme Court's Ka Pa'akai 0 Ka 'Aina v. Land Use Commission decision. Commensurate with the CIA, a revised AIS should be prepared to address, at a minimum, the entire 14.9 acres. 4) As noted in the application,the proposed uses at the guest ranch has the potential to generate some level of noise. The application itself admits that "[e]xcessive noise for past events has been cited by some neighbors as a concern." Given the scope and magnitude of the planned gatherings, we believe that the discussion in the Mr.Michael Yee,Director August 12,2020 Page 3 application of noise impacts is inadequate. We believe that a formal noise assessment should be prepared by a licensed professional acoustical engineer to determine whether the assumptions made regarding the noise impacts are accurate and whether the proposed mitigation measure of landscape plantings will be effective. 5) While we are cognizant of the division of authority that exists between the Land Use Commission("LUC") and the counties with respect to processing special permits involving land areas 15 acres or less, we have strong concerns about the way in which the acreage of this application area has been artificially separated from the rest of the subject parcel, The delineation of the 14.96-acre site to just under the 15- acre statutory threshold for consideration of special permits by the LUC leads us to believe that it is being done deliberately to circumvent the comprehensive review of the project by the LUC. We question whether the horseback riding and self-guided tours, among other activities, will be limited solely to the 14.9 acres. There is no indication that the remaining area of the subject parcel will be fenced off, or otherwise be inaccelsible to guests and non-guests alike during their stay at the guest ranch. In fact, as noted in the application, this remaining area contains the animal corrals that will presurlably house the horses that will be used for horseback riding and equine therapy as part of the guest ranch's activities. Until it is demonstrated otherwise, we believe that the remaining area constitutes an integral part of the guest ranch's open space,non- concrete environment concept promoted by the Applicant, and therefore should be included under the application and subject to LUC approval. We have no further comments to offer at this time. We appreciate the opportunity to comment on the subject application. Should you have any questions or require further clarification, please call our office at 587- 3822. Sincerely, Daniel E. Orodenker Executive Officer CAH ANNING DEPT RUG -x420 0 p 'n =._ DEPARTMENT OF PUBLIC WORKS EC`DMB FFtg COUNTY OF HAWAII H I LO, HAWAII DATE: August 13, 2020 Nelittneifidallt TO: Michael Yee, Planning Director FROM: Department of Public Works, Engineering Division V- SUBJECT: Special Permit Application (SPP-20-000219) Applicant: Puakea Ranch DBA: Kupunakane Ranch LLC Request: To Operate Puakea Ranch as a Guest Ranch Offering Activities and Events to Guests and the Local Community TMK: 3) 5-6-001:082 We have reviewed the subject request forwarded by your memo dated July 23, 2020 and provide the following: The subject parcel is in an area designated as Zone X on the Flood Insurance Rate Map FIRM) by the Federal Emergency Management Agency (FEMA). Zone X is an area determined to be outside the 500-year floodplain. All development-generated runoff shall be disposed of on site and not directed toward any adjacent properties. A drainage plan may be required by the Plan Approval process in accordance with Section 25-2-72(3) of the Hawaii County Code. Construction activities shall comply with the requirements of HCC, Chapter 10, Erosion and Sedimentary Control. Should there be any questions concerning this matter, please feel free to contact Kyle Honda of our Kona Engineering Division office at 323-4854. KH Planning Dept, Copy: ENG-HILO/KONA Exhil l,,.,.5...••• SCANNED AUG 172020 uty1 :15244 County of Hawaii is an Equal Opportunity Provider and Employer 3n a P FINNINGINGDEPT AUG 3 2020 f:1H :55 DEPARTMENT OF PUBLIC WORKS - TRAFFIC DIVISIOIIkYcS ppinDE1 P-FR COUNTY OF HAWAII PLAN REVIEW COMMENT SHEET Memorandum No. 2020 - 1131 Date Received: 7/28/2020 To: Michael Yee - Planning Director Date Transmitted: 7/31/2020 From: Traffic Division Subdivision/Project: Puakea Ranch DBA: Kupunakane Ranch LLC (SPC 20-000219) Subdivision/Project No: TMK: (3) 5-6-001:082 SIGNS/MARKINGS: d 1. R. Mangaoang Review Date: 7/29/2020 Initial: No Review See Attached Comments Comments on Plan/Sketch Other Comments No Comments 2. K. Pacheco Review Date:7/30/2020 Initial: No Review See Attached Comments Comments on Plan/Sketch Other Comments No Comments Recommend; condition of permit owner to install street light at driveway entrance along Hwy 270 for safety STREET LIGHTS/TRAFFIC SIGNALS: 3. M.Tebbakh Review Date: Initial: No Review See Attached Comments Comments on Plan/Sketch Other Comments No Comments 4. K.Higaki/D. Calicdan Review Date: Initial: No Review See Attached Comments Comments on Plan/Sketch Other Comments No Comments E 5. J. Patao/J. Peters Review Date: Initial: No Review See Attached Comments Comments on Plan/Sketch Other Comments No Comments ADMINISTRATION: J 6. A.Takaba Review Date: 7/31/2020 Initial: No Review See Attached Comments Comments on Plan/Sketch Other Comments El No Comments SCANNEDPlanningDant_ SCANNED Exhibit GAUG 0 4 7020 Now '.Harry Kim William A. Kucharski Mayor S f/;. Director Roy Takemoto kl4. f 0$• Diane A. Noda Managing Director Deputy Director County of Hawaii DEPARTMENT OF ENVIRONMENTAL MANAGEMENT 345 Kekuanao`a Street,Suite 41 • Hilo, Hawaii 96720 Ph: (808)961-8083 • Fax:(808)961-8086 Email: cohdem@hawaiicounty.gov zc:; Pi FINNING DEPT MEMORANDUM FOG IA 2020 p 2:07 RPTD ` IND D'ELI.' RED TO:Michael Yee, Director Planning Department FROM: William A. Kucharski, Director Environmental Management en DATE: August 14, 2020 SUBJECT:Special Permit Application (SPP 20-000219) Applicant: Puakea Ranch dba Kupunakane Ranch LLC Request: To Operate Puakea Ranch as a Guest Ranch Offering Activities and Events to Guests and the Local Community Tax Map Key: (3) 5-6-001:082 The Solid Waste Division has reviewed the subject application and offers the following comments and/or recommendations (contact the Solid Waste Division for details): No comments. X ) Commercial operations, State and Federal agencies, religious entities and non-profit organization may not use transfer stations for disposal. X ) Aggregates and any other construction/demolition waste should be responsibly reused to its fullest extent. X ) Ample and equal room should be provided for rubbish and recycling. X ) Green waste may be transported to the green waste sites located at the West Hawai'i Organics Facility and East Hawai'i Organics Facility, or other suitable diversion programs. X ) Construction and demolition waste is prohibited at all County Transfer Stations. X ) Submit Solid Waste Management Plan in accordance with attached guidelines. Existing Solid Waste Management Paan is to be followed. Provide update to the department on current status. Other: a 'C CL W SCANNED County of Hawai'i is an EquA Opportunity Provider and Employer AUG 1 7 2070 py) i5245 Mr. Michael Yee, Director August 14, 2020 Page 2 The Wastewater Division has reviewed the subject application and offers the following comments and/or recommendations (contact the Wastewater Division for details): X ) No comments. Require connection of existing and/or proposed structures to the public sewer in accordance with Section 21-5 of the Hawaii County Code. Require Council Resolution to approve sewer extension in accordance with Section 21- 26.1 of the Hawai'i County Code. Complete Sewer Extension Application. Require extension of the sewer system to service the proposed subdivision in accordance with Section 23-85 of the Hawai'i County Code. Check or line out as applicable: [ ] If required by the Director of the Department of Environmental Management ("Director of DEM"), [ ] applicant shall conduct a sewer study in accordance with the then applicable wastewater system design standards prior to approval to connect to the County sewer system. Applicant shall provide such sewer line or other facility improvements as the Director of DEM may reasonably require, which the sewer study may indicate are advisable for mitigation of impacts of the proposed project. Contact Wastewater Division Chief for details. Other: WK:mef Enclosure: Solid Waste Management Plan Guidelines a.;.,:,...,.,.„..,;,..... Harry Kim 1 Wt•+ .1•; i. William A.Kucharski Mayor 4• +.?ilS- i p Director Wilfred M.Okabe r•••It''' Diane A.Noda Managing Director Deputy Director Guntv of ciintuail DEPARTMENT OF ENVIRONMENTAL MANAGEMENT 345 Kekuan6o`a Street,Suite 41 • Hilo,Hawaii 96720 808)961-8083 • Fax(808)961-8086 help;J/wWw hawaiicounty.gav/environmental-management( January 30, 2017 SOLID WASTE MANAGEMENT PLAN Guidelines INTENT AND PURPOSE This is to establish guidelines for reviewing Solid Waste Management Plans, for which special conditions are placed on developments. The Solid Waste Management Plan will be used to: (1) promote and implement recycling and recycling programs, (2) predict the waste generated by the proposed development to anticipate the loading on County Solid Waste Management Facilities, and (3) predict the additional vehicular traffic being generated because of waste and recycling transfers. A qualified consultant shall prepare a suitable Solid Waste Management Plan for review by the Department of Environmental Management. REPORT The Solid Waste Management Plan will contain the following: 1. Description of the project and the potential waste it may be generating: i.e. analysis of anticipated waste volume and composition. This includes waste generated during the construction and operational or maintenance phases. Waste types shall include (but not be limited to): A. Organics (including food waste and green wastes); B. Construction and Demolition; C. Paper(including cardboard); D. Metal (including ferrous and non-ferrous metals); E. Plastic; F. Special (including ash, sludge, treated medical, bulky items, tires); G. Household Hazardous (including paint, vehicle fluids, oil, batteries); and H. Glass. 2. Indicate onsite source separation facilities by waste type; i.e. source separation bins of glass, metal, plastic, cardboard, aluminum, etc. Provide ample and equal space for rubbish and recycling. 3. Identification and location of the proposed waste reduction, waste re-use, recycling facility or disposal site and associated transportation methods for the various components of the development's waste management system, including the number of County of l iawai'i is an Equal Opportunity Provider and Employer. Solid Waste Management Plan Guidelines Page 2 of 2 vehicle movements and associated routes that will be used to transport the waste and recycled materials. 4. The report will include identification of any impacts to County-operated waste management facilities, and the appropriate mitigation measures that will be implemented by the development to minimize these impacts. 5. Analysis will be based on the highest potential use or zoning of the development. REQUIREMENTS AND CONDITIONS 1. A Solid Waste Management Plan will be prepared for all commercial developments, as defined under the policies of the Department of Environmental Management, Solid Waste Division. 2. The Department of Environmental Management will require the developer to provide or resolve all recommendations and mitigation measures as outlined in the solid waste management plan; besides any conditions placed on the applicant herein. 3. A State of Hawai'i licensed engineer will draft and certify in writing the Solid Waste Management Plan as complying with applicable Federal, State and County of Hawai'i Solid Waste Laws, Regulations, and Administrative Rules. Should you require additional information, please contact Greg Goodale, Solid Waste Division Chief, at (808) 961-8515. CONCUR: / William A. Kucharski DIRECTOR County of Hawaii is an Equal Opportunity Provider and Employer. OUST 3-3-1 H-WIG .. August 18, 2020 Mr. Michael Yee Planning Director Planning Department County of Hawai'i 101 Pauahi Street Suite 3 Hilo, HI 96720 Gentlemen: Subject: Special Permit Application (SPP 20-000219) Puakea Ranch DBA: Kupunakane Ranch LLC Hawi, North Kohala, Hawaii Island, Hawaii Tax Map Key: 3-5-6-001:082 Thank you for the opportunity to comment on the subject's Special Permit Application. Hawaiian Electric will be able to provide electrical service to the proposed "Guest Ranch" in North Kohala. A detailed analysis will be performed after the receipt of the consultant's detailed design drawings and estimated load. The following is a summary of our comments: 1. Generation capacity—As of January 2020, Hawaiian Electric's current system peak load is 192.1 MW and our total generation system capability is 242.2MW. Our firm generating reserve margin is 26.1% and may have adequate generation to serve the above. 2. Electrical Substation -The area is served by our existing Hawi Substation and 12,470 and 4,160 volts overhead distribution along Akoni Pule Highway. The capacity of our existing substation should be adequate to serve the new load. 3. Off-Site Electrical Distribution System —The existing off-site 12,470 and 4,160 volts distribution system along Akoni Pule Highway should be adequate to serve the proposed request. 4. On-Site Electrical Distribution System —On-site distribution line extensions, upgrades and easements may be required on the developer's property to serve the anticipated load. KR 5. New Utility Commercial Electrical Meter—A service request shall be open with 0t. Hawaiian Electric and a commercial meter installed to serve the proposed request. D CO After the development's detailed loading and civil plans are submitted, Hawaiian Electric will m prepare a firm cost to provide electrical power to this development. C C _Q C ..0 K WHawaiianElectric74-5519 KAIWI STREET, KAILUA-KONA, HI 96740 " County of Hawai'i Page 2 August 18, 2020 Hawaiian Electric recommends energy efficient and conservation measures to reduce the maximum electrical demand and energy consumption. The developer may call Hawaiian Electric's Customer Field Services division at (808) 935-1171 for questions or details on available programs. It is encouraged that the developer's electrical consultant open a service request with Hawaiian Electric Engineering division as soon as practicable to ensure timely electrical facility installation. If you have any questions, please email me at shelley.doctor@hawaiianelectric.com. Sincerely, Shelley Dot or Designer III T&D Engineering email: W. Sibayton Hawaiian Electric 74-5519 KAIWI STREET, KAILUA-KONA, HI 96740 Harry Kim Darren J. Rosario Mayor Fire Chief ie Robert R.K.PerreiraRoyTakemoto4;.;;i.r Deputy Fire ChiefManagingDirectorh ripp•N' County of Ti9Etivail HAWAII FIRE DEPARTMENT 25 Aupuni Street•Suite 2501•Hilo,Hanai`i 96720 808)932-2900•Fax(808)932-2928 August 25,2020 TO: MICHAEL YEE,PLANNING DIRECTOR FROM:DARREN J. ROSARIO,FIRE CHIEF SUBJECT: Application: Special Permit Application(SPP-20-000219) Applicant: Puakea Ranch DBA: Kupunakane Ranch LLC Request:To Operate Puakea Ranch as a Guest Ranch Offering Activities and Events to Guests and the Local Community Tax Map Key: (3)5-6:001:082 In regards to the above-mentioned application request,the following shall be in accordance: NFPA 1, UNIFORM FIRE CODE, 2006 EDITION Note: Hairai'I State Fire Code, National Fire Protection Association 2006 version, with ('oiintr ofHali'ai'I amendments. County amendments are identified with ca preceding "C-" of the reference code. Chapter 18 Fire Department Access and Water Supply 18.1 General. Fire department access and water supplies shall comply with this chapter. For occupancies of an especially hazardous nature, or where special hazards exist in addition to the normal hazard of the occupancy, or where access for fire apparatus is unduly difficult, or areas where there is an inadequate fire flow, or inadequate fire hydrant spacing, and the AHJ may require additional safeguards including,but not limited to, additional fire appliance units, more than one type of appliance, or special systems suitable for the protection of the hazard involved. 18.1.1 Plans. 18.1.1.1 Fire Apparatus Access. Plans for fire apparatus access roads shall be submitted to the fire department for review and approval prior to construction. Panning Dept. A„ Exhibit 9 t;, Harrel County is an Egnul Opportunity Provider and Employer. Michael Yee,Planning Director August 25,2020 Page 2 18.1.1.2 Fire Hydrant Systems. Plans and specifications for fire hydrant systems shall be submitted to the fire department for review and approval prior to construction. C— 18.1.1.2.1 Fire Hydrant use and Restrictions. No unauthorized person shall use or operate any Fire hydrant unless such person first secures permission or a permit from the owner or representative of the department,or company that owns or governs that water supply or system. Exception: Fire Department personnel conducting firefighting operations, hydrant testing, and/or maintenance, and the flushing and acceptance of hydrants witnessed by Fire Prevention Bureau personnel. 18.2 Fire Department Access. 18.2.1 Fire department access and fire department access roads shall be provided and maintained in accordance with Section 18.2. 18.2.2*Access to Structures or Areas. 18.2.2.1 Access Box(es). The AHJ shall have the authority to require an access box(es)to be installed in an accessible location where access to or within a structure or area is difficult because of security. 18.2.2.2 Access to Gated Subdivisions or Developments. The AHJ shall have the authority to require fire department access be provided to gated subdivisions or developments through the use of an approved device or system. 18.2.2.3 Access Maintenance. The owner or occupant of a structure or area,with required fire department access as specified in 18.2.2.1 or 18.2.2.2, shall notify the AHJ when the access is modified in a manner that could prevent fire department access. 18.2.3 Fire Department Access Roads. (*may be referred as FDAR) 18.2.3.1 Required Access. 18.2.3.1.1 Approved fire department access roads shall be provided for every facility, building, or portion of a building hereafter constructed or relocated. 18.2.3.1.2 Fire Department access roads shall consist of roadways, fire lanes, parking lots lanes, or a combination thereof. 18.2.3.1.3* When not more than two one- and two-family dwellings or private garages, carports, sheds, agricultural buildings, and detached buildings or structures 400ft2 (37 m2)or less are present, the requirements of 18.2.3.1 through 18.2.3.2.1 shall be permitted to be modified by the AHJ. Michael Yee,Planning Director August 25,2020 Page 3 18.2.3.1.4 When fire department access roads cannot be installed due to location on property, topography, waterways, nonnegotiable grades, or other similar conditions, the AHJ shall be authorized to require additional fire protection features. 18.2.3.2 Access to Building. 18.2.3.2.1 A fire department access road shall extend to within in 50 ft(15 m) of at least one exterior door that can be opened from the outside that provides access to the interior of the building. Exception: 1 and 2 single-family dwellings. 18.2.3.2.1.1 When buildings are protected throughout with an approved automatic sprinkler system that is installed in accordance with NFPA 13, NFPA 13D, or NFPA 13R, the distance in 18.2.3.2.1 shall be permitted to be increased to 300 feet. 18.2.3.2.2 Fire department access roads shall be provided such that any portion of the facility or any portion of an exterior wall of the first story of the building is located not more than 150 ft 46 m) from fire department access roads as measured by an approved route around the exterior of the building or facility. 18.2.3.2.2.1 When buildings are protected throughout with an approved automatic sprinkler system that is installed in accordance with NFPA 13, NFPA 13D, or NFPA 13R, the distance in 18.2.3.2.2 shall be permitted to be increased to 450 ft (137 m). 18.2.3.3 Multiple Access Roads. More than one fire department access road shall be provided when it is determined by the AHJ that access by a single road could be impaired by vehicle congestion, condition of terrain, climatic conditions, or other factors that could limit access. 18.2.3.4 Specifications. 18.2.3.4.1 Dimensions. C— 18.2.3.4.1.1 FDAR shall have an unobstructed width of not less than 20ft with an approved turn around area if the FDAR exceeds 150 feet. Exception: FDAR for one and two family dwellings shall have an unobstructed width of not less than 15 feet, with an area of not less than 20 feet wide within 150 feet of the structure being protected. An approved turn around area shall be provided if the FDAR exceeds 250 feet. C— 18.2.3.4.1.2 FDAR shall have an unobstructed vertical clearance of not less then 13ft 6 in. C- 18.2.3.4.1.2.1 Vertical clearances may be increased or reduced by the AHJ, provided such increase or reduction does not impair access by the fire apparatus, and approved signs are installed and maintained indicating such approved changes. Michael Yee, Planning Director August 25,2020 Page 4 18.2.3.4.1.2.2 Vertical clearances shall be increased when vertical clearances or widths are not adequate to accommodate fire apparatus. C 18.2.3.4.2 Surface. Fire department access roads and bridges shall be designed and maintained to support the imposed loads(25 Tons) of the fire apparatus. Such FDAR and shall be comprised of an all-weather driving surface. 18.2.3.4.3 Turning Radius. C— 18.2.3.4.3.1 Fire department access roads shall have a minimum inside turning radius of 30 feet, and a minimum outside turning radius of 60 feet. 18.2.3.4.3.2 Turns in fire department access road shall maintain the minimum road width. 18.2.3.4.4 Dead Ends. Dead-end fire department access roads in excess of 150 ft(46 m) in length shall be provided with approved provisions for the fire apparatus to turn around. 18.2.3.4.5 Bridges. 18.2.3.4.5.1 When a bridge is required to be used as part of a fire department access road, it shall be constructed and maintained in accordance with county requirements. 18.2.3.4.5.2 The bridge shall be designed for a live load sufficient to carry the imposed loads of fire apparatus. 18.2.3.4.5.3 Vehicle load limits shall be posted at both entrances to bridges where required by the AHJ. 18.2.3.4.6 Grade. C— 18.2.3.4.6.1The maximum gradient of a Fire department access road shall not exceed 12 percent for unpaved surfaces and 15 percent for paved surfaces. In areas of the FDAR where a Fire apparatus would connect to a Fire hydrant or Fire Department Connection, the maximum gradient of such area(s) shall not exceed 10 percent. 18.2.3.4.6.2* The angle of approach and departure for any means of fire department access road shall not exceed 1 ft drop in 20 ft(0.3 m drop in 6 m) or the design limitations of the fire apparatus of the fire department,and shall be subject to approval by the AHJ. 18.2.3.4.6.3 Fire department access roads connecting to roadways shall be provided with curb cuts extending at least 2 ft (0.61 m)beyond each edge of the fire lane. Michael Yee, Planning Director August 25,2020 Page 5 18.2.3.4.7 Traffic Calming Devices. The design and use of traffic calming devices shall be approved the AHJ. 18.2.3.5 Marking of Fire Apparatus Access Road. 18.2.3.5.1 Where required by the AHJ, approved signs or other approved notices shall be provided and maintained to identify fire department access roads or to prohibit the obstruction thereof of both. 18.2.3.5.2 A marked fire apparatus access road shall also be known as a fire lane. 18.2.4* Obstruction and Control of Fire Department Access Road. 18.2.4.1 General. 18.2.4.1.1 The required width of a fire department access road shall not be obstructed in any manner, including by the parking of vehicles. 18.2.4.1.2 Minimum required widths and clearances established under 18.2.3.4 shall be maintained at all times. 18.2.4.1.3* Facilities and structures shall be maintained in a manner that does not impair or impede accessibility for fire department operations. 18.2.4.1.4 Entrances to fire departments access roads that have been closed with gates and barriers in accordance with 18.2.4.2.1 shall not be obstructed by parked vehicles. 18.2.4.2 Closure of Accessways. 18.2.4.2.1 The AHJ shall be authorized to require the installation and maintenance of gates or other approved barricades across roads, trails, or other accessways not including public streets, alleys, or highways. 18.2.4.2.2 Where required, gates and barricades shall be secured in an approved manner. 18.2.4.2.3 Roads,trails, and other access ways that have been closed and obstructed in the manner prescribed by 18.2.4.2.1 shall not be trespassed upon or used unless authorized by the owner and the AHJ. 18.2.4.2.4 Public officers acting within their scope of duty shall be permitted to access restricted property identified in 18.2.4.2.1. Michael Yee, Planning Director August 25,2020 Page 6 18.2.4.2.5 Locks, gates, doors,barricades, chains, enclosures, signs, tags,or seals that have been installed by the fire department or by its order or under its control shall not be removed, unlocked, destroyed, tampered with, or otherwise vandalized in any manner. 18.3 Water Supplies and Fire Hydrants 18.3.1* A water supply approved by the county, capable of supplying the required fire flow for fire protection shall be provided to all premises upon which facilities or buildings, or portions thereof, are hereafter constructed, or moved into or within the county. When any portion of the facility or building is in excess of 150 feet(45 720 mm) from a water supply on a fire apparatus access road, as measured by an approved route around the exterior of the facility or building, on- site fire hydrants and mains capable of supplying the required fire flow shall be provided when required by the AHJ. For on-site fire hydrant requirements see section 18.3.3. EXCEPTIONS: 1. When facilities or buildings, or portions thereof, are completely protected with an approved automatic fire sprinkler system the provisions of section 18.3.1 may be modified by the AHJ. 2. When water supply requirements cannot be installed due to topography or other conditions, the AHJ may require additional fire protection as specified in section 18.3.2 as amended in the code. 3. When there are not more than two dwellings, or two private garage, carports, sheds and agricultural. Occupancies, the requirements of section 18.3.1 may be modified by AHJ. 18.3.2* Where no adequate or reliable water distribution system exists, approved reservoirs, pressure tanks, elevated tanks, fire department tanker shuttles, or other approved systems capable of providing the required fire flow shall be permitted. 18.3.3* The location, number and type of fire hydrants connected to a water supply capable of delivering the required fire flow shall be provided on a fire apparatus access road on the site of the premises or both, in accordance with the appropriate county water requirements. 18.3.4 Fire Hydrants and connections to other approved water supplies shall be accessible to the fire department. 18.33 Private water supply systems shall be tested and maintained in accordance with NFPA 25 or county requirements as determined by the AHJ. 18.3.6 Where required by the AHJ, fire hydrants subject to vehicular damage shall be protected unless located within a public right of way. Michael Yee,Planning Director August 25,2020 Page 7 18.3.7 The AHJ shall be notified whenever any fire hydrant is placed out of service or returned to service. Owners of private property required to have hydrants shall maintain hydrant records of approval, testing, and maintenance, in accordance with the respective county water requirements. Records shall be made available for review by the AHJ upon request. C- 18.3.8 Minimum water supply for buildings that do not meet the minimum County water standards: Buildings up to 2000 square feet, shall have a minimum of 3,000 gallons of water available for Firefighting. Buildings 2001- 3000 square feet, shall have a minimum of 6,000 gallons of water available for Firefighting. Buildings, 3001- 6000 square feet, shall have a minimum of 12,000 gallons of water available for Firefighting. Buildings, greater than 6000 square feet, shall meet the minimum County water and fire flow requirements. Multiple story buildings shall multiply the square feet by the amount of stories when determining the minimum water supply. Commercial buildings requiring a minimum fire flow of 2000gpm per the Department of Water standards shall double the minimum water supply reserved for firefighting. Fire Department Connections (FDC) to alternative water supplies shall comply with 18.3.8 (1)- 6)of this code. NOTE: In that water catchment systems are being used as a means of water supply for firefighting, such systems shall meet the following requirements: 1) In that a single water tank is used for both domestic and firefighting water, the water for domestic use shall not be capable of being drawn from the water reserved for firefighting; 2) Minimum pipe diameter sizes from the water supply to the Fire Department Connection FDC) shall be as follows: a) 4"for C900 PVC pipe; b) 4" for C906 PE pipe; c) 3" for ductile Iron; d) 3' for galvanized steel. Michael Yee,Planning Director August 25,2020 Page 8 3) The Fire Department Connection(FDC) shall: a) be made of galvanized steel; b) have a gated valve with 2-1/2 inch, National Standard Thread male fitting and cap; c) be located between 8 ft and 16 ft from the Fire department access. The location shall be approved by the AHJ; d) not be located less than 24 inches, and no higher than 36 inches from finish grade, as measured from the center of the FDC orifice; e) be secure and capable of withstanding drafting operations. Engineered stamped plans may be required; f) not be located more than 150 feet of the most remote part, but not less than 20 feet,of the structure being protected; g) also comply with section 13.1.3 and 18.2.3.4.6.1 of this code. 4) Commercial buildings requiring a fire flow of 2000gpm shall be provided with a second FDC. Each FDC shall be independent of each other, with each FDC being capable of flowing 500gpm by engineered design standards. The second FDC shall be located in an area approved by the AHJ with the idea of multiple Fire apparatus'conducting drafting operations at once, in mind. 5) Inspection and maintenance shall be in accordance to NFPA 25. 6) The owner or lessee of the property shall be responsible for maintaining the water level, quality, and appurtenances of the system. EXCEPTIONS TO SECTION 18.3.8: 1) Agricultural buildings, storage sheds, and shade houses with no combustible or equipment storage. 2) Buildings less than 800 square feet in size that meets the minimum Fire Department Access Road requirements. 3) For one and two family dwellings, agricultural buildings, storage sheds, and detached garages 800 to 2000 square feet in size, and meets the minimum Fire Department Access Road requirements, the distance to the Fire Department Connection may be increased to 1000 feet. 4) For one and two family dwellings, agricultural buildings, and storage sheds greater than 2000square feet, but less than 3000 square feet and meets the minimum Fire Department Access Road requirements,the distance to the Fire Department Connection may be increased to 500 feet. Michael Yee,Planning Director August 25,2020 Page 9 5) For buildings with an approved automatic sprinkler system, the minimum water supply required may be modified. If there are any questions regarding these requirements, please contact Deputy Fire Chief Robert Perreira at(808) 932-2902. DARREN J. ROSARIO Fire Chief RP:nac OQ WATO4GAArl. ar U 4 a DEPARTMENT OF WATER SUPPLY • COUNTY OF HAWAII 3,1.0 W_ is-345 KEKUANAO'ASTREET, SUITE 20 • HILO, HAWAII 96720 TELEPHONE(808)961-8050 • FAX(808)961-8657 August 26, 2020 CON PLANNING DEPT AUG 28 2020 c 4Ii:57 TO: Mr. Michael Yee, Director Planning Department FROM: Keith K. Okamoto, Manager-Chief Engineer SUBJECT: Special Permit Application (SPP 20-000219) Puakea Ranch DBA: Kupunakane Ranch LLC Request: To Operate Puakea Ranch as a Guest Ranch Offering Activities and Events to Guests and the Local Community Tax Map Key 5-6-001:082 We have reviewed the subject request and have the following comments and conditions. Please be informed that the subject parcel is served by an existing master meter which also provides 1 service to eight(8) other parcels. The master meter is allowed an average usage of 3,600 gallons per day or 400 gallons per day for each parcel (adequate for only one (1) single-family dwelling/parcel). The Department will note that the average daily water consumption through the existing master meter, over the past 2-year period, is approximately 6,022 gallons per day. This consumption is 1.7 times the average daily allotment of water. As the current water usage is already exceeding the capacity of the existing meter and due to the additional water demand that will be generated by the applicant's requested increased activities, the Department recommends that the applicant and/or customers consult with a professional engineer to determine means to reduce the amount of potable water usage on the parcels served by the master Q. 'meter. 0 C The applicant has indicated that they will utilize private rainwater catchment systems for any additional water demand. We have no objection to the use of rainwater catchment systems; however. ,•_ we cannot approve or comment as to the adequacy of those systems as they do not meet the C requirements of the Department's Water System Standards. a •— X c WWerecommendthattheowner(s) consult with the County of Hawai`i. Planning Department. the County of Hawai`i, Department of Public Works, and/or the State of Hawai`i, Department of Health. to determine any other guidelines,recommendations, or regulations regarding the use of rainwater catchment systems. SCANNED Water, Our ,tost Precious Resource. . . Ka WaiA ?bane . . s p 0 1 2020 The Department of Water Supply is an Equal Opportunity provider and employer 55 '77 Mr. Michael Yee, Director Page 2 August 26, 2020 Should there be any questions, please contact Mr. Ryan Quitoriano of our Water Resources and Planning Branch at 961-8070, extension 256. Sincerely yours, VAIM444016) Keith K. Okamoto, P.E. Manager-Chief Engineer RQ:dfg copy — Kupunakane Ranch LLC Harry Kim Ike; Paul K.Ferreira Mayor Police Chief 11 r_+ss', v.r•o•H',:i'Kenneth Bugado,Jr. Deputy Police Chief County of Hawai'i POLICE DEPARTMENT 349 Kapi'olani Street • Hilo,Hawai'i 96720-3998 CM PLANNING DEPT AUGUST 14, 2020 808)935-3311 • Fax(808)961-2389 AUG 10 2020 AH 10:19 REC'D HAND DELIVERED TO MICHAEL YEE, PLANNING DIRECTOR G,/ FROM : ROBERT WAGN R ASSISTANT CHIEF, AREA II OPERATIONS SUBJECT : SPECIAL PERMIT APPLICATION (SPP 20-000219) APPLICANT: PUAKEA RANCH DBA: KUPUNAKANE RANCH LLC REQUEST: TO OPERATE PUAKUA RANCH AS A GUEST RANCH OFFERING ACTIVITIES AND EVENTS TO GUESTS AND THE LOCAL COMMUNITY TAX MAP KEY: (3) 5-6-001:082 This is in response to your Memorandum dated July 23, 2020 regarding the above-referenced Special Permit Application by Puakea Ranch DBA: Kupanakane Ranch LLC. Staff has reviewed the application and has no comments or objections to offer at this time. Should you have any questions or concerns, please contact Captain Jeremie Evangelista, Commander of the North Kohala District, at (808) 889-6540. JCE/jaj 20HQ0604 PEarring Dept. Exhibit it SCANNED AUG 2 4 MU Hawai'i County is an Equal Opportunity Provider and Employer"5 SUZANNE D.CASE AVM Y!GE ae•.'#1CRASRFERSON AMR FHAWAI BOARD OF LANDAND NATURAL RESOURCES COMMISSION DNWATER RESOURCE e t SIANAOEMENT aye+ro STATE OF HAWAII 1010 -1 P 12: 52 jr.,,;,,,,,,,?DEP kRTJ1E\T OF LAND AND NATURAL RESOURCES LAND DIVISION RECEIVED POST OFFICE flUX 621 LAND DIAVuIStAjON HONOLULU,HAWAII 96809 it 0 t1nM August 7, 2020 MEMORANDUM TO: DLNR Agencies: Div. of Aquatic Resources (kendall.l.tucker(ahawaii.gov) Div. of Boating & Ocean Recreation (richard.t.howard@ahawaii.o,o ) X Engineering Division (DLNR.ENGRahawaii.gov) X Div. of Forestry &Wildlife(rubyrosa.t.terrago@hawaii.gov) Div. of State Parks (curt.a.cottrell .hawaii.gov) X Commission on Water Resource Management(DLNR.CWRM(ahawaii.gov) Office of Conservation & Coastal Lands(sharleen.k.kubaithawaii.gov) X Land Division—Hawaii District(gordon.c.heihawaii.gov) X Historic Preservation (DLNR,Intake SHPDcahawaii'.gov FROM: Russell Y. Tsuji, Land Administrator Russe/ Tsuji SUBJECT: Special Permit Application (SPP 20-000219)— Request to Operate Puakea Ranch as a Guest Ranch Offering Activities and Events to Guests and the Local Community LOCATION: 56-2864 Akoni Pule Highway, Hawi, Island of Hawaii; TMK: (3) 5-6-001:082 APPLICANT:County of Hawaii on behalf of Puakea Ranch dba Kupunakane Ranch LLC Transmitted for your review and comment is information on the above-referenced subject matter which can be found at: https://hawaiioimt- mv.shareboint.com/:f:/q/personal/dariene k nakamura hawaii qov/EruY5mmcBgBBgDCcAicF eHsBIFVOnHG e4K9107gmedw?e=WVhf4Z Please submit comments by August 20, 2020. if no response is received by the above date, we will assume your agency has no comments. Should you have any questions about this request, please contact Darlene Nakamura at darlene.k.nakamura(a hawaii.gov. Thank you We have no objections. We have no comments Comments are attached. Signed: NI Print Name: —rine A.i G. IZ '/7 Division l///t n Date: Attachments C cc: Central Files s.i SUZANNE D.CASE DAVID Y.IDE CHAIRPERSON GOVERNOR OFHAWAII BOARD OFLAND AND NATURAL.RESOURCES COMMISSION ON WATERRESOURCE MANAGEMENT ovoci andA'ar4, STATE OF HAWAII yDEPARTMENT OF LAND AND NATURAL RESOURCES14!e.,t HO." LAND DIVISION POST OFFICE BOX 62! HONOLULU,HAWAII 96809 August 7, 2020 FROM: MEMORANDUM DLNR Agencies: Div. of Aquatic Resources (kendall.l.tucker ac hawaii.gov) Div. of Boating & Ocean Recreation (richard.t.howard aahawaii.gov) X Engineering Division (DLNR.ENGRa.hawaii.gov) X Div. of Forestry &Wildlife (rubvrosa.t.terragonu.hawaii.gov) Div. of State Parks(curt.a.cottrell(a.hawaii.gov) X Commission on Water Resource Management(DLNR.CWRMhawaii.gov) Office of Conservation &Coastal Lands (sharleen.k.kubaahawaii.gov) X Land Division—Hawaii District(gordon.c.heitahawaii.gov) X Historic Preservation (DLNR.Intake.SHPD a(hawaii.gov) TO: Russell Y. Tsuji, Land Administrator Russell Istij SUBJECT: Special Permit Application (SPP 20-000219)—Request to Operate Puakea Ranch as a Guest Ranch Offering Activities and Events to Guests and the Local Community LOCATION: 56-2864 Akoni Pule Highway, Hawi, Island of Hawaii; TMK: (3) 5-6-001:082 APPLICANT:County of Hawaii on behalf of Puakea Ranch dba Kupunakane Ranch LLC Transmitted for your review and comment is information on the above-referenced subject matter which can be found at: https://hawaiioimt- mv.sharepoint.com/:f:/q/personal/darlene k nakamura hawaii qov/EruY5mmcBQBBgDCcAicF eHsBIFVOnHG e4K9liB7gmedw?e=WVhf4Z Please submit comments by August 20, 2020. If no response is received by the above date, we will assume your agency has no comments. Should you have any questions about this request, please contact Darlene Nakamura at darlene.k.nakamura(c hawaii.gov. Thank you. additional We have no bjections. v ) We have no,.comments. Comments are attached. Signed: 6 Print Name: Carty Chang, Chief Engineer Division: Engineering Division Date: Aug 20,2020 Attachments cc: Central Files P :inni g Dept. Exhibit l3 Mr. Yee, DirectorCO s PLANNING DEPTAUG282020of1.1.:54 c/o Hawaii County Planning Dept. 101 Pauahi Street #3 RECO BY HAIL Hilo Hawaii 96720 Special permit Number (SPP 20-000219) APPLICANT: Puakea Ranch Christine Cash Request: To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local communityTaxMapKey: (3) 5-6-001 :082 August 23, 2020 Dear Sir, My wife and I had a brief visit to Hawi and Puakea Ranch in 2017. Christie Cash was kind enough to explain some of the interesting history of the North Kohala region and the important role Puakea Ranch played in those years. The preservation of the cowboy bunkhouse and the other architectural features from that era seems an important endeavor. I understand that part of the special use application will include a small museum that will dedicated to highlighting this history. Beyond that, I am also supportive of providing increased flexibility to Puakea Ranch so that it can preserve this heritage. I expect that Puakea Ranch will add to the stability and economy of the broader community. While in Hawi we shopped in an art gallery and dined in a small local restaurant. I look forward to a return visit to Hawi and Puakea Ranch. Jeff Strathern 9802 Gas House Pike Frederick, Maryland f Fanning Dept. 21701 Exhibit ia+ SCANNED SEP O 1 2020 Mori, Ashley From: Lisa Ebrahimi <ashawiturnsl @gmail.com> Sent: Friday,August 28, 2020 11:17 AM To: Planning Internet Mail COH PLANNING DEPTSubject:Puakea Ranch AUG 28 2020 PH12:29 Planning Commision This is a letter to the Planning Dept to show my support of Christi Cash and her request for a Special Use Permit. I have lived in Hawi for 30 years and have had a business in Hawi for 28 years. We need businesses like Puakea Ranch. It's a small footprint with a giant positive impact for our economy. Because of Christi Cash and Puakea Ranch, my business and the other businesses in Hawi have reaped the benefits of having a small Eco Ranch with vacation rentals. It has brought visitors to our little town and also has employed many local residents which in turn helps our whole community. Puakea Ranch has meticulously restored the existing plantation houses on the property. Christi Cash runs a farm growing fruits and vegetables. Puakea ranch has cows, goats, sheep, horses and chickens. It is a workingfarmandranch. This is exactly what we need in North Kohala. Please accept her request for a Special Use Permit. Thank you, Lisa Ebrahimi As Hawi Turns LLC PO Box 178 55-3412 Akoni Pule Highway Hawi, HI 96719 808-889-5023 Panning Dept. Exhibit 5___ SCANN1 1 15' 9 Mori, Ashley From: Marcelle "Maki" Loren 808-545-1000 texts welcome CoI-1 PLANNING DEPTmloren@islandmortgagehawaii.com> AUG 28 2020 PH12:29Sent: Thursday,August 27,2020 6:39 PM To: Planning Internet Mail Subject: SPP 20-000219;,APPLICANT: Puakea Ranch Christine Cash, Request:To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community,Tax Map Key: (3) 5-6-001:082 Aloha County of Hawaii Planning Department, I write this letter to express strong support for the SPP application by Christine Cash for her vision for Puakea Ranch. Puakea Ranch pays tribute to generations of community members. Its intended activities will serve as an inspiration for North Kohala residents and business owners making it a cultural destination and furthermore making North Kohala a better and more interesting place to live and work. Consistent her her reputation, Christine Cash has worked diligently with local community members as well as civic and political leaders throughout the planning of this project. The project has engaged many residents from diverse backgrounds. It has brought together community member and leaders to talk not only about Puakea Ranch but also to discuss broader community concerns and visions for North Kohala. This project deserves your full support. I look forward to the successful completion of the vision for Puakea Ranch. Marcelle Loren, Resident ofmakai neighbor, Puakea Bay Ranch, 56-2898 Haleakala View Place, Hawi HI 96719 and a local mortgage broker since 1976, President ofIsland Mortgage. Pinning Dep;. Exhibit R0 SCANNED SEP 0 1 2020 1t,:tpl3.5593 Mori, Ashley From: Roy,Alex Sent: Wednesday,August 26, 2020 9:58 AM FLAI DEPT To: Mori,AshleyPM•3 Cc: Darrow,Jeff Subject:FW: Special permit Number(SPP 20-000219) AUG 26 2020 Please intake for Puakea Ranch SPP, Mahalo! Alex J. Roy Planner VI County ofHawai'i Planning Department 101 Pauahi St., Ste. 3 Hilo, HI 96720 alex.rov(tii,hawaiicounty.gov 808-961-8140 planning.hawaiicounty.gov From:Yee, Michael <Michael.Yee@hawaiicounty.gov> Sent:Wednesday,August 19,2020 9:19 PM To: Darrow,Jeff<Jeff.Darrow@hawaiicounty.gov> Cc: Roy,Alex<Alex.Roy@hawaiicounty.gov> Subject: Fwd: Special permit Number(SPP 20-000219) Please intake for Puakea Ranch SPP application. Sent from my iPhone Begin forwarded message: From: Erin Pasco<colorcatering@gmail.com> Date:August 19,2020 at 5:37:07 PM HST To: "Yee, Michael" <Michael.Yee@hawaiicounty.gov> Subject:Special permit Number(SPP 20-000219) Q. APPLICANT: Puakea Ranch Christine Cash Request:To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community C —0TaxMapKey: (3)5-6-001:082 C .0t3X Good morning Mr.Yee, As the owner and business proprietor of a local catering company called Color Catering, I am writing in support for Puakea Ranch to receive appropriate permits for their venue to continue servicing wedding clients here on the big Island of Hawaii. From a catering standpoint,their ability to host even s significant impact, not only on my business but on many other vendors in the community wh 's i T 1}VF0 1 SEP 0 1 0 pt55 businesses are interdependent on the availability of venues such as Puakea Ranch. What's unique about how Christie and her team manages this venue that differs from an independent vacation rental is their unique position to be directly supporting all of the wedding vendors in terms of referrals for their clients and the attraction of many people to attend the events that support the sustainable economic interests of our island. I'm not familiar with the issues that any neighbors may have that might impede the permitting process, but my experience with Puakea Ranch during many events is that they are very courteous neighbors to their community and take every measure to ensure noise levels are reasonable and impacts are minimum to surrounding properties and all music is turned off by 10pm every event we are a part of. Being that we are in rural agricultural areas with more space between property, Big Island has a unique opportunity to host larger weddings and gatherings that do support many local businesses not just in the wedding industry. As a wedding professional for over 10 years, I would surmise that if we lose these larger venues our wedding clients would choose other venues off island. I feel it is a definite economic and social boost to our community at large to have venues such as Puakea Ranch to showcase and support our rural agriculture to clients world wide. We depend on such alliances with our vendors to survive in these economic times. We are in this together! Thank you very much for your kind consideration in this matter to support this vital local business. Sincerely, Erin Pasco Color Catering Paauilo Hawaii 808-557-5507 colorcateringPgmail.com 2 Mori, Ashley From: Yee, Michael Sent: Thursday, September 10, 2020 1:06 PM G DEPTTo: Mori,Ashley9-72 y,= - r, i Subject: FW: Puakea Ranch special hearing t ' } Please intake to Jeff. Note, I think this may have already come in as a hard copy. Original Message From:terin johnston <terinjohnston29@gmail.com> Sent:Thursday,September 10, 2020 1:01 PM To:Yee, Michael <Michael.Yee@hawaiicounty.gov>; Christie Cash <christie@puakearanch.com> Subject: Puakea Ranch special hearing Sent from my iPad Dear Mr.Yee, I am writing to you in regards to: SPP 20-000219 Applicant: Puakea Ranch/Christy Cash Request:To operate Puakea Ranch as a Guest Ranch offering AG activities and non AG activities/events for guests and the local community Tax Map Key: (3)5-6-001:082 My family lives in Puakea Bay Ranch directly across from Puakea Ranch and we are one of the closest in proximity to Christy's property.We have never heard any noise, music, or extra traffic in the three years we've been here. Christy has always been gracious with her time,given me a personal tour, a private number should I be disturbed by any guests or noise to have it handled immediately, and an invitation to help harvest her amazing garden. I have no hesitation to support her endeavors with this property. She has managed to not only preserve this heritage property but has created opportunity to include the community, old and young to participate in various activities. I feel that this brings a positive addition to beautiful Hawi offering something other than souvenir shops or run of the mill lodging. It's a marvel and I fully recommend that the council visit to see what has been done to retain some Hawaiian cultural history. It is a destination must see on the Big Island and that is great news for us all. I thank you for your time in this matter and truly hope that this can be a beautiful addition to our island. Yours, Terin Johnston tanning Dept. Exhibit S_____ SCANNED SEP 1 5 2020 Subject: Special Permit number (SPP 20-000219) Applicant: Puakea Ranch, Christie Cash Request: To operate Puakea Ranch as a Guest Ranch offering agricultural activities and non- agricultural activities/events to guests and the local community. Tax Map Key: (3) 5-6-001:082 Date: September 11, 2020 Dear Mr. Yee and Members of the Planning Commission: We are writing to express our support for the special use permit being requested for Puakea Ranch. The Ranch has been an integral part of our landscape for decades and now, with the refurbishing of the property and the opportunities for our community to visit the Ranch, we can partake in all of what the Ranch has to offer. Ms. Cash has developed a business plan that brings the community together. From outings for our seniors to cultivating the Ranch's agriculture offerings for our community, we will all benefit from the Ranch being able to utilize all of its assets. In addition to our own direct benefits, our community will benefit from the guests that come to stay at the Ranch by the mere fact that they will shop in our stores, eat in our restaurants, and partake in our tourist adventure outings offered in North Kohala. We need businesses that will thrive in North Kohala and Puakea Ranch is poised to provide our community with much needed local jobs, tourist activity and a place for local people to congregate for a variety of events. Thank you for your time in reviewing this special use permit request. Sincerely, Katherine, Steve and Daniel Groves Hawi, Hawaii Small business owners and residents) Planning Dept. Exhibit ( 9 Mori, Ashley From: olivia ebrahimi <oliviaebra@gmail.com> Sent: Wednesday, September 02, 2020 9:46 AM 2.To: Planning Internet Mail y . - _- t Subject: Puakea Ranch Aloha, I know Christie Cash and her beautiful ranch at Puakea. I have attended a number of community events there and have really appreciated that we have such a resource in our little town of Hawi. I remember the first time I attended an auction raising funds for North Kohala was at Christie's ranch at Puakea. I was so impressed with her generosity and I still am. She truly loves the history of the ranch and has stories and photos of the old cowboys that lived there. Her organic garden has been a nice source of food for the community. I don't know the details of why she does not have a special permit to host events etc, but I think it would be very sad for Kohala if her ranch was not available and running. I hope you approve the permit she needs to keep her ranch open and running. o Olivia Mahal lival Ebrahimi Planning Dept. Exhibit 20 SCANNED SEP 0-4 2020 1 E!!!!..1.41.5,23.0,_ Thanks Olivia 808-936-2393 2 Mori, Ashley From: Catalina Cain <catcain@comcast.net> Sent: Tuesday, September 01, 2020 6:22 PM R:--- M -rP,TTo: Planning Internet Mail SEP 3 2020 PM OR Subject: Puakea Ranch Aloha Planning Department, I am writing this email in support of Christie Cash and her beautiful property known as Puakea Ranch in Hawi. I have lived in Kapaau for eight years and met Christie through my son as I landed in Kona. My son, Joshua Alt has worked for her on the ranch for many years. I was welcomed into the most wonderful Ohana immediately through this connection, a testament to the type of person Christie has been in this community. Over the years I have attended a variety of events, both private and open to the public donated parties and charity gatherings. It has been a source of pride for me as mother to the manager of this amazing place. And as I grow closer to Christie, became inspired and educated about the area and the meaning of the land to the local people. I have listened to her tell stories that she was gifted with from the Hawaiians and others who have worked to build, who work on this land now and yes even some who were born in these houses. Her devotion to the history of Puakea Ranch is something she proudly shares with everyone who steps on the Aina. Her commitment to preserve the integrity of these 33 acres through planting, maintaining the homes and guarding the trees, plants and wildlife are of utmost importance to her. I have heard her say she wants to accommodate those who are against her, but find it hard to communicate with the opponents. I personally know no one who lives in North Kohala who doesn't hope for her to receive the "special permit" she is striving to attain. Her reputation for being generous, a steward of this land and an huge asset to our little paradise is well known. And so, I urge you to listen to the many who are in support of Christie and approve the permit she needs to keep Kohala thriving and self-sustaining. I am convinced this land is loved and cared for even if there have been mistakes in its evolution. Christie deserves to continue with all the required changes. And so, I ask you to move forward in a timely manner so we who love the ranch can enjoy it for many years to come. Sincerely, Catalina Cain Punning Dept. Exhibi'------ SCANNED SEP 040 0 1 3.- 35 1 i4i4"0-3,z , ,,2 ,1 Oteg goct-R, D 4w 1/te%icihq re/ea(.7 /00-t)rd it,tvcle 1 ea,bame ., o Ica)a3-0:cc: Cou,* /LNG PEP - 1 .1 Pct.(4,11,;. s;:e6bf uE1-33:[ 2020 pH3:22-1 g,h) ifo,to-aLL 96 7Z 0 REco BY MAIL Refe,(eac: 5-ioec,(4.. t 19e-4414;/kaMbele- (SeP ZO 219) A-,PPLf0A-Nr: f4)Qkealawc4aili15-//1/4--Cask net tieshr -r; Ofe,410 b4,KeRe co, a, 6046q4-/VG ii eXg/p? 16 Pch011ig-c a Mci NON a/ILA-vial i1112. LoCe&C&yy1 fii MO KEY: (3) 5-6 --(Xi A 6 g2 SCANNED SEP 0 3 2020 fRoka MR. yee Fforfial..6_5 8 6,e. 0 v A po.s. OF fice, etyyyt frttu,o`c/r1;A/ i's Artf_a cii my suppo fOlz itta, sob e_dj-. ee&Cioiv bec-6/R6 -Ar2, Itacis'a.Jc.-1, ol) opcp,m7-#167vr. Y:otrt a Ici Irzem. gat i:i0R eseArra, srRo1N G.3 6.ert yea& PLA[6: Pewi: Ak ct,4 hr:ARM/W": 6 ir It AO b ee Al /416 W" kitot4 6-ife).2 PS SiitiC‘j:5i/e4J/a, Wed(a)-(4. Ofti aft e) et, pko. gcvvteA 7: AavgiVot eeitit/ at,C ie RetRtebeeqii -L - Our C A A676-Werk to MT ff yvt.A... eLjfrkm. lur;I/Re-11)&1 ectgij ikivr- e4 K 17etsti// CA/117-i?vgat,ICAAt'/: t4)heN frc,trq45 PoccKeaRA-Nah Th mvi6w1- ' 1 • I4cooKilvy 4-44-la/K g4KyttiAlliZee I A; 14,4 4/ --,- Cbci 51E4' 1-g-g-okoccRyie;46-64-Hta,-1--/-4 /04, a 0 w Pv61,ke4 /RCIAt di 15 ;leo i/1,:. --1-m-(01 ,,e;,_q-,4-tobitic t,q 4v*s17 ert5strilefa4=, 'A,Wilkerili-/-4011eVocis.: ni - eN' ScypIk w c :z- 1 72- x 10tAkeaictA)CC-1 JSAe, cc-tdij -1G__,A;e0-r--Fy-i'rne,C, Aa_,+-w-ie_, Neet — ILI to Re110104448100; 4 ro5t- 001/1 I) ou.5ii0.6.5SSJ 6 ci`k 5t.ItcLW, Id. P'f4/6-,C5 C"'''n, a/v;TYC jtuLtavivt 61 ck 1 f(f r,.' AC:ct4 nfeR00_4- ilevaN' 144904 I-D V Stitre55 ES. r(), S 5frta,(I 6031,Ae 5.9 Ad, m iit,/54 Rfi- /f/ i L el - J.( 'II c 1_. `,41- 1 CAPT.JAMES F. CASH i z 311 Savannah Circle Foley,Alabama 36535 Jfc7601@yahoo.com 310)463-6902 August 24, 2020 Mr. Yee,Director do HAWAII COUNTY PLANNING DEPARTMENT 101 Pauahi Street No. 3 Hilo,Hawaii 96720 Re: Special Permit No. (SPP 20-000219) Applicant: Puakea Ranch Christie Cash Request:To Operate Puakea Ranch as a Guest Ranch offering AG Activities and Non-AG Activities/Events to Guests and the Local Community Dear Mr. Yee, More than 35 years ago, my daughter Christie Cash was a 15 year-old cheerleader in Michigan. She was chosen out ofthousands of applicants to cheer at the Pro Bowl football game being held in Honolulu. She came home from that amazing and significant experience and said Dad, someday I want to live in Hawaii." Twenty years later, I received a call from Christie, who by that time was a successful executive producer living with her husband and my two grandchildren in Los Angeles. She was on a hill overlooking what is now Puakea Ranch with her realtor and said, "Dad I'vefound where I want to spend the rest ofmy life." She was staring down on the overgrown, and dilapidated remains of what used to be the headquarters of the 19th Century ranch and sugarcane plantation started by James Wight, who also fell in love with the people and land and made a life,help start a church,raised a family, and is buried not far away on the Island. Unfortunately,this old historical landmark of the 19th and early 20th Century Hawaiian culture was all but lost. The Planning Department did not even have it on their maps. Christie took a huge leap of faith, arranged to buy the property from a developer that had bought these acres from the Parker Ranch,and started to bring it back to life. She begged and borrowed from her family to scrape up the down payment,and solicited volunteers, including yours truly,to spend months sleeping in tents to slowly restore these historic buildings for the benefit of preserving the history,the culture and the grandeur of this remarkably beautiful pie S ANT .. Nanning Dept. Exhibit 2' 1......155.59 Mr. Yee, Director August 24,2020 Page 2 It would have been much easier and less expensive to bulldoze these old buildings with their outdoor toilets, and single wall construction. However, she knew it was something special that must be preserved. She hired a local conservationist, an historic architect,preservation carpenters, and a team of attorneys—because as stated, the Planning Department did not know what they had. Their records showed 33 acres of vacant land designated for one house and one kitchen,when in fact, paniolos for the Parker Ranch, and subsequently several local families, had been living on the property for years in the various existing and now historical buildings. Those initial and very ambitious efforts occurred 15 years ago. During the years following and up to the present, Christie has been making fantastic strides to achieve a successful business to allow her to maintain Puakea Ranch, its history,the culture and share it with others who would love and appreciate an experience of real Hawaii,rather than the glitzy high rise hotels on the beach that may as well be Miami. That being said, the struggles encountered to obtain permits have been long and arduous, as documented with various governmental departments. Finally, there is some encouragement at the end ofthe long, long tunnel which gives hope that perhaps the Planning Department will let Puakea Ranch see the light at the end ofthis journey. As a proud Father and investor in preserving the Hawaiian culture, I strongly encourage and support the granting of this Application, and hope that your Department is inspired to do so for the reasons put forth herein—not only for Christie's dogged determination, but more importantly to allow for the continuation of the historical significance this property brings to the local community on the Kohala Coast and many future visitors to the Island, for years to come. Respectfully yours, jr,144'Y eowl/ James F. Cash 2 Mori, Ashley From: Bamboo Restaurant <bamboorestauranthawaii@gmail.com> Sent: Friday,August 21, 2020 12:23 PM To: Planning Internet Mail C r. °_i N NG DEPT Subject: Puakea Ranch, Hawi 1 ''?el 9020 Pm3:25 Regarding the following Special Permit: Special permit Number (SPP 20-000219) APPLICANT: Puakea Ranch Christine Cash Request: To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community Tax Map Key: (3) 5-6-001:082 I am the owner of Bamboo Restaurant in Hawi, where we have served our guests for nearly 3o years. I want to strongly urge you to allow the special permit to allow Puakea Ranch to operate as a Guest Ranch with agricultural and non-agricultural activities. In order to preserve the rural nature of our community while providing food and guest services is critical to the future of Kohala. We NEED Puakea to be a Guest Ranch so that our children can stay and work in the community, grow food, and share our way of life. Please allow Puakea Ranch this special permit. It is critically important and necessary. Mahalo, Joan Channon, owner Bamboo REstaurant & Gallery, Hawi Nanning Dept. Exhibit 2-4" SCANNED 1 AUG 2 8 2020 Mori, Ashley From: Yee, Michael Sent: Friday, August 21, 2020 10:04 AM To: Mori, Ashley; Darrow,Jeff CIJH PLANNING DEPT Subject: FW: Special permit Number (SPP 20-000219) AUG 24 2020 F112:26 Ashley- Please intake as public comment for SPP 20-000219 to Jeff. Original Message From: Karen Johnson <kdjohnsonmd78@gmail.com> Sent:Thursday,August 20, 2020 5:57 PM To:Yee, Michael <Michael.Yee@hawaiicounty.gov> Cc: Christie Cash <christie@puakearanch.com> Subject: Special permit Number(SPP 20-000219) RE:Special permit Number(SPP 20-000219) APPLICANT: Puakea Ranch Christine Cash Request:To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community Tax Map Key: (3)5-6-001:082 Dear Mr.Yee, My husband and I are residents of Puakea Bay Ranch. We welcome the addition of the activities and events requested by Puakea Ranch.This is especially important given the changes and loss of businesses and revenue in North Kohala as a result of the pandemic. I have personally visited Puakea Ranch and was very impressed with the beauty of the place and the attention to preserving the history of the ranch.This Ranch is a gem and a valuable asset to the entire community. Activities at Puakea Ranch have no adverse effect on our ranch or the surrounding neighborhood due to the rural location and lack of proximity to any residences. I am strongly in favor of approving the requested permit. Aloha, Karen Johnson, 56-3026 Puakea Bay Drive, Hawi, HI 96719 Planning Dept. Exhibit 2 SCANNED Mori, Ashley From: Sophia Bowart <sophiabowart@gmail.com> Sent: Friday,August 21, 2020.12:17 PM COH PLANNING DEPT. To: Planning Internet Mail AUG 24 2020 PP4 Cc: Christie Cash Subject: Special permit Number (SPP 20-000219) Dear Mr. Yee, We are writing in support of Puakea Ranch getting a special permit to operate as a guest ranch offering AG activities and Non-Ag activities/events to guests and the local community. Special permit Number (SPP 20-000219) APPLICANT: Puakea Ranch, Christine Cash Request: To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community Tax Map Key: (3) 5-6-001:082 This small Agri tourism business provides comfortable accommodations in North Kohala, at a historic ranch with rich history, while also supporting our local economy in our historic small town by promoting local food producers, ranchers, dairies, rum makers, small shops and restaurants. There are very few historic properties left with this kind of history to be shared with such a wide audience. Christie Cash is respecting the ancestors of the place by offering an opportunity for guests to dive deep into the history of the Kawamoto family and North Kohala's rich multicultural history. Thank you. Sincerely, Sophia Bowart & Ralph Neil Logan III 57-1691 North Kohala Mountain Road, Hawi, 96719 FOREST AGRICULTURE RESEARCH MANAGEM ENT CENTER www.farmcenter.orq Nanning E Dept. 415.860.3606 (cell) Xhlbl.t O SCANNED AUG 2 8 20201 P!i a4 482 Mori, Ashley From: Yee, Michael Sent: Friday, August 21, 2020 10:29 AM To: Mori,Ashley C P: FINN_} D-P— 9 5 cr F 5i3 39iFINNING DF_PT 24Subject: FW: Christie Cash Special Use Permit peG0 F" i' Ashley- Please intake as public comment for SPP 20-000219 to Jeff. From:Alexandra Star<starsaffire@gmail.com> Sent:Thursday,August 20, 2020 8:17 AM To:Yee, Michael <Michael.Yee@hawaiicounty.gov> Subject: Christie Cash Special Use Permit Special permit Number(SPP 20-000219) APPLICANT: Puakea Ranch Christine Cash Request: To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community Tax Map Key: (3) 5-6-001:082 Dear Mr. Yee: I am writing to support Christie Cash in her application for a Special Use Permit for her property that lies exactly adjacent to mine. We share a common boundary line. While I only purchased my property two years ago, I already feel a special bond with these ancient lands and historic ranching properties on which we live, properties that have now been subdivided to allow more residents while maintaining the agricultural essence of the land. I will personally have no objection to Christie's receiving this Special Use Permit for the purposes that she has outlined. She has a beautiful property which she has greatly enhanced during her tenure there, including the lovely historic buildings and sympathetic landscaping. Her vegetable gardens are a boon to the neighborhood, providing fresh organic produce, fruit, and eggs to neighbors and friends. Christie has restored the historic buildings on her ranch to a high degree of aesthetic taste, while maintaining the 'paniolo' and 'rancher' theme. Guests from the mainland thoroughly enjoy the atmosphere and flavor of her ranch and enjoy the completely relaxed time they spend there, while getting to know more about historic Kohala. Please let me know if there is anything else I can do to help in this process. Again, I have absolutely no objection to the Special Permit. Sincerely yours, Alexandra Star Owner of Lot 4 n i Dep;. SCANNED Exh .._ 2 ' 584283t 1 Mori, Ashley From: Yee, Michael H PUNNING DEPT Sent: Friday,August 21, 2020 10:17 AM AUG24 9 s0 Pm :26 To: Mori, Ashley; Darrow, Jeffs- ` — - - ted Lam= Subject: FW:YES! AE! To Puakea Ranch for their Special Use permit (SPP 20-000219) Importance: High Ashley- Please intake as public comment for SPP 20-000219 to Jeff. From: Calley O'Neill <Calley@CalleyONeill.com> Sent:Thursday,August 20, 2020 1:04 PM To:Yee, Michael <Michael.Yee@hawaiicounty.gov> Cc: Christie Cash<christie@puakearanch.com>; Calley O'Neill<calley@calleyoneill.com>; Leianna Eads leianna.e@gmail.com>; Bryan Gazaui <bryan@gazaui.com>; Noa Eads<noaeads@gmail.com>;Jameson Luskay jcluskay@gmail.com>;Jeremiah Holguin <djeote@icloud.com>;julia@theramaexhibition.org Subject: YES! AE! To Puakea Ranch for their Special Use permit (SPP 20-000219) Importance: High RE: Special permit Number(SPP 20-000219) APPLICANT: Puakea Ranch Christine Cash Request: To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community Tax Map Key: (3) 5-6-001:082 Dear Mr.Yee, My family and I have known and loved Puakea Ranch ever since owner, Christie Cash began her long and arduous journey of research, oral histories, and restoration on the cottages and the homes. Not only does Christie Cash deserve to be granted a Special Permit for a guest ranch, but encouraged and applauded for her efforts. This is exactly the kind of agricultural , history, culture, ecological, sustainable, and hospitality filled venue that can provide a model for our Big Island economic recovery. I say this ESPECIALLY because Christie is interested in hosting our community in agricultural and health related gatherings. The community means the world to Christie and citizens like Christie mean the world to our green economic post-coved recovery. Our Aloha `Aina future, which is our only future. Please! Do call me for any further recommendation or referral or information. I am here to assist. Malama Honua, Calley CONSERVATION ARTIST Mann ung Dept.' SCANNED Exhibit 25 AM 2 820 0,,1354Id4 PO Box 6571 Kamuela,Hawai'i 96743 Mobile: (808)987-7003 www.CalleyONeill.com www.TheRamaExhibition.org Calley responds to emails weekday evenings. If you wish to reach her sooner,please call or text(808) 987-7003. 2 Mori, Ashley From: Robert Defazio <rcdefazio@yahoo.com> Sent: Monday, August 24, 2020 7:08 AM C01-1 P3 ANNI G DEPTTo: Planning Internet MailAi IS 24 2020 N3:29 E=i e ' — Subject: puakea RECTI BY EMAIL in regards to the special permit for the Puakea ranch. This would a good thing for our community. Having a place for special events, outdoors classes and market. Also a great peaceful place to stay and relax. I fully support this permit. Aloha Robert r tanning Dept. Exhibit 2-9 SCANNED 1 AUG 2 8 2020 41.1-35480 Mori, Ashley From: Yee, Michael rn-; Ps a,NN: G DEP;i{''aaae3's Sent: Monday, August 24, 2020 11:23 AM AUGG 24 2020 P43:28 To: Mori, Ashley Cc: Darrow, Jeff Subject: FW: Spp2000219 Ashley- Please intake as public comment for SPP 20-000219 to Jeff. From:Jon Adams<adamsjon37@gmail.com> Sent:Thursday,August 20, 2020 7:28 AM To:Yee, Michael<Michael.Yee@hawaiicounty.gov> Subject: Spp2000219 Aloha Mr.Yee as a 41 year resident of north kohala. I have started 7 business in town been actively involved in most community planning and other organizations and would like to encourage approval of Christie Cash's application.Her proposed use of this historic property helps all in our town.she provides needed jobs as well as accommodations for guests that support all of our merchants. Thank you for your consideration. Jon Adams Planning Dept. SCANNED 1 Exhibit_ So - A p351/O , Mori, Ashley From: Barbara Davis <barbdavis20@gmail.com> CL; PLANKB-46 rhs Sent: Saturday, August 22, 2020 11:07 AM AUG 21 9020 P 31 To: Planning Internet Mail Subject: Special permit Number (SPP 20-000219)APPLICANT: Puakea Ranch Christine Cash Request:To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community Tax Map Key: (3) 5-6-001:082 Special permit Number (5PP 20-000219) APPLICANT: Puakea Ranch Christine Cash Request: To Operate Puakea Ranch as a Guest Ranch offering AG Activities and non ag activities/events to guests and the local community Tax Map Key: (3) 5-6-001:082 Dear Mr. Yee and Planning Dept, We live in Puakea Bay Ranch which is across the highway from Puakea Ranch. We are in full support of the efforts of the Ranch and hope that you grant the special permit as soon as possible. Puakea Ranch is a gem of our community and Christie Cash is one of the most generous people I know. Please help our community by keeping the ranch going with this special permit! Mahalo, Barbara and Bill Davis 56-2996 Puakea Bay Drive Hawi, HI 96719 Panning Dept. SCANNED Exhibit 3 f AUG 2 8 2020 pt. 4 '7 9 1 Mori, Ashley From: Virginia Fortner <Vfortner@hotmail.com> Sent: Thursday, September 03, 2020 9:16 PM I PLANNING riFFri To: Planning Internet Mail CFP 17 2020 F*2:3 Subject: Puakea Ranch Aloha Planning Department, I have enjoyed time at Puakea Ranch several times during the eight years I've lived in Hawi area. Each visit has been a pleasant time of aloha when I've entered that beautiful property. I'm grateful for Christie Cash's thoughtful planning, reverence for the history and sacredness of the land, welcoming attitude, and attention to detail as the farm/ranch reached out to community and serves visitors to the Big Island. While watercoloring (at Christie's invitation) with a group of plein air painters twice on property, I noticed that each house has literature and history from the property's early days to give visitors a sense of the importance of the aina; during fundraisers for Kohala's Visitor's Center, I've watched hundreds of people park, eat, hold an auction, enjoy the spectacular sunset, and join in generous aloha-spirit for our community with a surprisingly low volume of noise. Another fond memory is of Christie calling Bingo after serving 65-or-so Senior Citizens a yearly Thank You Dinner at the pavilion. We kupuna felt honored for their many contributions in Kohala as volunteers, parents, and grandparents. I've been lucky enough to return to my farm roots during informal visits to Puakea Ranch by helping to feed the chickens, goats, and horses. The gardens have fed me, and I've been in the pools. Everything is tended with care, and the considerable workload seems carried out without complaint. I urge you to give the approval that Kristie is seeking as soon as possible. The ranch deserves to thrive and continue to contribute to our community during these times. I also urge you to keep open communication with Christie about matters concerning the ranch. I'm sure you will find her flexible, respectful, responsible, and willing to listen. Sincerely, Virginia Fortner 54-460 Honomakau Road 406 210 2454 Nanning Exhibit 31--- SCANNED SEP 09 202(1 1 p .13..5 __7_ r August 13,2020 VIA CERTIFIED LETTER Planning Director Michael Yee County of Hawaii Planning Department 101 Pauahi Street,Suite 3 O fL, I 1'1J FPIP1 A G 17 2090 PM2:22Hilo,Hawaii 96720 RECD BY MAIL RE: Designation of Puakea Ranch as a"Hotel" Dear Planning Director Michael Yee; As a follow-up to previous correspondence to you,' I respectfully ask that the County of Hawaii Planning Department provide a determination as to whether the proposed expansion of Puakea Ranch described in the 2/14/2020 Final Environmental Assessment(FEA)and the 6/21/2020 Special Permit Application meets the definition of a"hotel"per §25 1-5(b) ofthe Hawaii County Code. Hotel"means a building or group ofbuildings containing six or more rooms or suites which provides transient lodging accommodations, meals, entertainment, and various personal services for compensation, whether such establishment is called a hotel, motel, motor hotel, motor lodge, inn, or otherwise. Information in the FEA and Special Permit application appear to conform to this definition based upon information in these two documents as indicated in the following text. Hotel Definition Final Environmental Assessment and Special Permit Application—Puakea Guest Ranch means a building or group of The Guest Ranch wouldbe able to accommodate as many as 38 visitors buildings containing six or more rooms in the seven rental units and the event area, an increase from the or suites that provides transient lodging current occupant capacity of 18. [Special Use Permit Background;A. accommodations ... Proposed Use Description,pg.2]Three swimming pools currently on the property. meals... The Guest Ranch would include a certified kitchen to allow cateringfor guest events and other special events. [Special Use Permit Background; A.Proposed Use Description,pg. 3] entertainment... Obtaining the Special Permit would allow advertisement as a "Guest Ranch"offering activities, opportunities and events, such as marriages, birthday parties, anniversary celebrations,farm to fork events to our guests, local school and our local community members. [Final Environmental Assessment,pg. 5] The Proposed Action would continue the vacation rentals and construct facilities that would allowfor variousfunctions including weddings and community events. [Special Use Permit Background;A.Proposed Use Description,pg.3] Three swimming pools are currently on the property. and various personal Examples: Private chef($50/hr),private art classes($225),yoga and services for compensation... meditation in wedding pavilion($100 for up to 4 people);private archery pro rated starting at$150),massage(starting from$135 per person and$1 person,per couple,at your accommodations); childcare($20/1u-)etc.2 Certified letters to Planning Director Michael from Robert Morrison dated January 10 and March 6,2020. 2 https://www.puakearanch.com/tour-the-cottages/meet-the-experts/#1544108419064-fe2e0a33-b224 [Accessed on 8/11/2020] SCANNEDNanningDept. AUG 1 8 2020 Exhibit $$ Br 1 3 5 2 93 JD AUG 2 0 2020 VeiPlanning Director Michael Yee Puakea Ranch SES' 0 1 int/AOAugust 13,2020 k whether such establishment is called Puakea Ranch Hotel—Hawi;3 Hawaii's Hottest Hotel in Hawi;a A hotel, motel, motor hotel, motor Hawi Hotels;5 Puakea Ranch and Farm;6 Guest Ranch—Private Historic lodge, inn, or otherwise. Vacation Homes—Concierges service available;7 Puakea Ranch— Barn/Farm/Ranch Bed&Breakfast/Inn;8 Hotels/Motels Puakea Ranch VISIT WEBSITE 456 Lincoln Blvd. Santa Monica,CA 90402 9 Proposed Catering The Final Environmental Assessment and Special Permit Application propose a certified catering kitchen.10 While allowed in commercial,mixed use, limited industrial and general industrial districts," a catering kitchen is not a permitted use in residential and agricultural districts per§25-5-52. 12 We therefore ask for the County of Hawaii Planning Director to determine whether a catering kitchen will be allowed at Puakea Ranch. A copy of this correspondence has been mailed to Dakota Frenz,Esq.who I understand is handling the litigation on behalfof the County of Hawaii regarding Puakea Ranch. Please feel free to contact me directly ifyou have any questions about this information or require documentation regarding these issues. Sincerely yours, R0/71—\--t#1;52- 1/ 6;.-.._ Robert Morrison P.O. Box 195 Hawi, HI 96719 808-884-5291 (office) Cc: Dakota Frenz,Esq.,Office of Corporation Counsel 3 https://puakea-ranch-hawi.ibooked.ca/[Accessed on 8/13/2020] a Hawaii Tribune Herald,November 25,2012.Hawaii's hottest hotel in Hawi 5 Trip Advisor listing ofPuakea Ranch under"Hawi Hotels" https://www.tripadvisor.com/Hotel Review160582-dl235011-Reviews-Puakea Ranch- Hawi Island of Hawaii Hawaii.html#REVIEWS[Accessed on 8/12/2020] 6 FarmStaysus.com[http://www.farmstayus.com/farm/Hawaii/Puakea_Ranch_and_Farm Accessed on 9/12/2017] 7 Kona Chamber of Commerce The Source 2018.Puakea Ranch/Vacation Rentals/B&Bs[http://konakohalachamber chambermaster.com/list/member/puakea-ranch-1641 Accessed on 2/16/2018] 8 Venue Report[https://www.venuereport.com/venue/puakea-ranch/Accessed on 4/9/2019] 9 Chamber of Commerce of Hawaii Puakea Ranch[https://business.cochawaii.org/list/member/puakea-ranch-santa-monica- 20297.htm Accessed 8/12/2020] 1°Final Environmental Assessment,pg.5;Puakea Guest Ranch Special Permit,pg.3. 11 Chapter 25 Sections 25-5-112;25-5-132;25-5-142;25-5-152 12 Chapter 25, Section 25-5-52. 2